DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and robo4

DIOPT Version :9

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:XP_689255.3 Gene:robo4 / 560765 ZFINID:ZDB-GENE-020809-1 Length:1134 Species:Danio rerio


Alignment Length:451 Identity:103/451 - (22%)
Similarity:169/451 - (37%) Gaps:136/451 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 LLHVNQAHQDDRGYYMCQVNTNPMISQVGYLQVVVPPNILDIESTPSSVAVRENQNINMTCRADG 173
            |:|...:|: ||.:   :...:.::|::         |:..|...||.|.||......::|||:|
Zfish    45 LMHQRASHR-DRAH---RRKGSRLVSEI---------NLPRIVHHPSDVVVRVGSPATLSCRAEG 96

  Fly   174 FPAPKIIWRREDGEEIAVEK----KKKVLVYDA-----DVLPLTKVSRNEMGAYLCIATNGVPPS 229
            .|.|.|.|.| :|:.:..:|    .:.:::.|.     .|:|..|...:| ..|.|||.|.:..:
Zfish    97 NPEPTIQWLR-NGQPLDTDKMDAQSQPIVLPDGSLFFFSVVPGRKGQSHE-AVYACIAHNSIGNA 159

  Fly   230 VSKRIILDV-----EFSPMIWVPNQLVGAPSGTDV------TIDCHTE-AHPKAIIYWVYNSVMV 282
            .|:...|.:     :|...          ||..:|      ||:|... .||:..:.|..:.:::
Zfish   160 TSRNASLHIAALREDFRVQ----------PSDVEVAIGEMATINCSPPVGHPEPNVTWRKDGILI 214

  Fly   283 LPSKKYKTDYTENSYRAHMKLTIRNLQYGDFGNYRCISKNSLGETE---GSIRVYEIPL----PS 340
            ..|.::   |||    ...||.|...|..|.|.|.||:.|.:|..|   ..:.|...|:    |.
Zfish   215 NSSNEH---YTE----LKGKLIIAPAQKNDSGVYSCIASNMIGVRESRAARLSVLAKPVLLRKPE 272

  Fly   341 TPSKQVTHT-------------TVE-SRENNIIPSSRN--DTTKSLQ------TDVG-YA--MKN 380
            ..|.|:..:             ::| |||...:|:.|.  :...|||      .|:| |:  ::|
Zfish   273 DVSVQLGESAQFFCEADGDPMPSIEWSREQGPLPNGRYLINPDHSLQIHYVTAQDMGRYSCTVEN 337

  Fly   381 DLYPGSASS----SSSGGS---------------------SSAASSSSSMQTSALPGGVAGNSLS 420
            .|....||:    ..:||:                     .|.||:.|.:..          .|.
Zfish   338 KLGVSVASAQLLVEDAGGTRLRDLHKELSALRVSLENVTVMSTASNMSQVMW----------KLQ 392

  Fly   421 SMGSKGSLAIGKSTFYTERPP--NEYAASSVAGLLLH--------------RALLFGSGIY 465
            |.||:.....|....|....|  :::.|..|....||              :...:||.:|
Zfish   393 SFGSQPHYLEGFEVLYRSLLPASSDWTAQRVPQPSLHTHVGPLKRGYKYEFKVRPYGSSLY 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 6/33 (18%)
Ig 145..238 CDD:416386 30/101 (30%)
Ig strand A 145..149 CDD:409353 1/3 (33%)
Ig strand A' 154..159 CDD:409353 3/4 (75%)
Ig strand B 165..172 CDD:409353 2/6 (33%)
Ig strand C 178..183 CDD:409353 2/4 (50%)
Ig strand C' 185..187 CDD:409353 0/1 (0%)
Ig strand D 195..199 CDD:409353 0/3 (0%)
Ig strand E 203..209 CDD:409353 2/5 (40%)
Ig strand F 216..223 CDD:409353 3/6 (50%)
Ig strand G 230..238 CDD:409353 2/7 (29%)
Ig 242..333 CDD:416386 25/100 (25%)
Ig strand A' 250..253 CDD:409353 0/2 (0%)
Ig strand B 259..266 CDD:409353 4/12 (33%)
Ig strand C 272..277 CDD:409353 1/4 (25%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 0/3 (0%)
Ig strand E 295..305 CDD:409353 2/9 (22%)
Ig strand F 314..322 CDD:409353 4/7 (57%)
Ig strand G 325..334 CDD:409353 2/11 (18%)
robo4XP_689255.3 Ig1_Robo 70..169 CDD:143317 29/100 (29%)
I-set 71..168 CDD:254352 29/98 (30%)
I-set 175..261 CDD:254352 26/102 (25%)
Ig2_Robo 177..261 CDD:143201 25/100 (25%)
I-set 265..350 CDD:254352 20/84 (24%)
Ig 282..350 CDD:299845 16/67 (24%)
FN3 373..448 CDD:214495 15/84 (18%)
FN3 472..560 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.