DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and tmigd1

DIOPT Version :10

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001091718.3 Gene:tmigd1 / 559127 ZFINID:ZDB-GENE-080303-6 Length:249 Species:Danio rerio


Alignment Length:233 Identity:59/233 - (25%)
Similarity:95/233 - (40%) Gaps:35/233 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 IESTPSSV------AVRENQNINMTCRADGF-PA--PKIIWRREDGEEIAVEKKKKVLVYDADVL 205
            :||.|.:|      ||.|  .:.:||..|.. |:  .::.|.| :|..:.:.::..:......|.
Zfish    23 VESCPLAVGSLLQTAVEE--TVTLTCMTDNTDPSSQQELQWFR-NGARVKLPEENMMSRSSLCVQ 84

  Fly   206 PLTKVSRNEMGAYLCIATNGVPPSVSKRIILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHPK 270
            |:||   .:.||.......| ..||:..:..||.:.|.:....: |......|..:.|...|:|.
Zfish    85 PVTK---EDDGAVFTCQLKG-DASVNSTVEFDVRYPPDLNDTTE-VFVQETNDAVLSCEVRANPP 144

  Fly   271 AIIYWVYN-SVMVLPSKKYKTDYTENSYRAHMKLTIRNLQYG-DFGNYRCISKNSLGETEGSI-- 331
            ..:.|..: .|:.|.:..||:  |.|...|  :|||..|:.. ..|.|.|.:|:::....|..  
Zfish   145 VTVVWKKDGEVLDLTTGSYKS--TNNGITA--QLTIPKLKRDVHQGLYVCETKSAMYGVTGRTFQ 205

  Fly   332 -----RVYEIPL-PSTPSKQVTHTTVE----SRENNII 359
                 ||...|| |:.....|...|:.    ||.|.|:
Zfish   206 VTVEDRVIGFPLGPTIAGVVVVACTIVLALISRRNKIM 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG_like 51..143 CDD:214653
Ig strand B 61..65 CDD:409353
Ig strand C 74..78 CDD:409353
Ig strand E 105..112 CDD:409353
Ig strand F 122..127 CDD:409353
Ig strand G 134..137 CDD:409353
Ig 145..238 CDD:472250 23/96 (24%)
Ig strand B 165..169 CDD:409353 0/3 (0%)
Ig strand C 178..182 CDD:409353 0/3 (0%)
Ig strand E 203..207 CDD:409353 1/3 (33%)
Ig strand F 217..222 CDD:409353 1/4 (25%)
Ig strand G 231..234 CDD:409353 0/2 (0%)
Ig 242..333 CDD:472250 23/99 (23%)
Ig strand B 259..263 CDD:409353 0/3 (0%)
Ig strand C 272..276 CDD:409353 0/3 (0%)
Ig strand E 295..305 CDD:409353 3/9 (33%)
Ig strand F 315..320 CDD:409353 2/4 (50%)
Ig strand G 328..331 CDD:409353 1/2 (50%)
tmigd1NP_001091718.3 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.