DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and lrit3a

DIOPT Version :9

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001122166.1 Gene:lrit3a / 558559 ZFINID:ZDB-GENE-080723-63 Length:636 Species:Danio rerio


Alignment Length:508 Identity:94/508 - (18%)
Similarity:177/508 - (34%) Gaps:121/508 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FILTVVKLLLIALN----IFPSRFTNRRIMFLIYMT-NLVTHVMMDEPRFAQPIPNVTVAVGRDA 61
            :.|:.::.|.|..|    :.|..|.|.:::..:.:. |::.....:.   .:.:|::......:.
Zfish    78 YYLSELRYLWITYNSITSVDPGSFYNLKVLHELRLDGNMIATFPWES---LKEMPSLKTLDLHNN 139

  Fly    62 NLPCVVEHLGGY--KVAWIHIDRQMILTIHRHVISRIPRYS-ITYTDNTWLLHVNQAHQDDRGYY 123
            .|..|......|  .:.::.|....:.|:...::...|.:| |..:.||....| ...||:..|.
Zfish   140 RLTSVPVEAAPYLINITYLDISSNKLTTLPSDLVDIWPPFSGIQPSANTSQKTV-LGLQDNPWYC 203

  Fly   124 MCQVNTNPMISQVGYLQVVVPPNIL------------------------DIESTPSSVAVRENQN 164
            .|:::....:|::..:.||:...:|                        .:.::.:.:......|
Zfish   204 DCRISKLIELSKMAGIPVVLMDQVLTCSGPEHLSGVLFQRAELDQCVKPTVMTSATKITSPLGSN 268

  Fly   165 INMTCRADGFPAPKIIWRREDGEEIAVEKKKKVLVYDA-------DVLPLTKVSRNEMGAYLCIA 222
            :.:.|.|:|||.|.::|...||..:     ...:|.::       .:|.|..:...:.|.|.|.|
Zfish   269 VLLRCDANGFPTPTLLWTTADGSVV-----NNTVVQESPGEGVRWSILSLHSIVFKDAGDYRCKA 328

  Fly   223 TNGVPPSVSKRIILDVE-------FSPMIWVPNQLVGAPSG--TDVTIDCHTEAHPKAIIYWVYN 278
            .| |..:....|.|.|:       |.| |.:..|....|:.  |...:...|...|..|   ...
Zfish   329 KN-VAGNAEAYITLSVDGVQPTTPFPP-INITKQPEDQPTTTFTPTKMPLFTSLSPITI---TTR 388

  Fly   279 SVMV-----------LP-----------SKKYKTDYTENSYRAHMKLTIRNLQYGDFGNYRCISK 321
            .||.           :|           .|..|...::|...:..|..||:::..:         
Zfish   389 PVMTTMPPLTTRKSPIPGGGVQRSPPAGDKPAKVQQSKNGKGSIKKSDIRDIEVVE--------- 444

  Fly   322 NSLGETEGSIRVYEIP-LPSTPSKQVTHTTVESRENNIIPSSRNDTTKSLQTDVG-------YAM 378
               ..||.::.::... |||.....|.:          .|....|..:::.|:||       |.|
Zfish   445 ---ETTETAVLLWSAEGLPSDTPLTVVY----------FPYDAKDDKETVDTEVGQGKLLLEYLM 496

  Fly   379 KNDLYPGSASSSSSGGSSSAASSSSSMQTSALPGGVAG-NSLSSMGSKGSLAI 430
            .|.:|.....:.|||.......|:..:      ||..| |.:..:.|..:.||
Zfish   497 PNQVYTVCLVTKSSGKEQCVDFSTLEI------GGEEGQNKVLMIASAIACAI 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 18/94 (19%)
Ig 145..238 CDD:416386 22/123 (18%)
Ig strand A 145..149 CDD:409353 1/27 (4%)
Ig strand A' 154..159 CDD:409353 0/4 (0%)
Ig strand B 165..172 CDD:409353 1/6 (17%)
Ig strand C 178..183 CDD:409353 1/4 (25%)
Ig strand C' 185..187 CDD:409353 1/1 (100%)
Ig strand D 195..199 CDD:409353 0/3 (0%)
Ig strand E 203..209 CDD:409353 2/5 (40%)
Ig strand F 216..223 CDD:409353 3/6 (50%)
Ig strand G 230..238 CDD:409353 2/7 (29%)
Ig 242..333 CDD:416386 19/114 (17%)
Ig strand A' 250..253 CDD:409353 0/2 (0%)
Ig strand B 259..266 CDD:409353 0/6 (0%)
Ig strand C 272..277 CDD:409353 1/4 (25%)
Ig strand C' 281..283 CDD:409353 1/12 (8%)
Ig strand D 289..293 CDD:409353 1/3 (33%)
Ig strand E 295..305 CDD:409353 2/9 (22%)
Ig strand F 314..322 CDD:409353 0/7 (0%)
Ig strand G 325..334 CDD:409353 2/8 (25%)
lrit3aNP_001122166.1 LRR_8 81..141 CDD:290566 8/62 (13%)
leucine-rich repeat 83..106 CDD:275378 6/22 (27%)
LRR_4 107..145 CDD:289563 3/40 (8%)
leucine-rich repeat 107..130 CDD:275378 1/25 (4%)
LRR_8 129..>171 CDD:290566 6/41 (15%)
LRR_4 129..170 CDD:289563 6/40 (15%)
leucine-rich repeat 131..154 CDD:275378 3/22 (14%)
leucine-rich repeat 155..168 CDD:275378 1/12 (8%)
TPKR_C2 199..249 CDD:301599 6/49 (12%)
Ig 252..343 CDD:299845 21/96 (22%)
IG_like 261..343 CDD:214653 21/87 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.