| Sequence 1: | NP_001097508.2 | Gene: | DIP-delta / 5740816 | FlyBaseID: | FBgn0085420 | Length: | 469 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001018174.2 | Gene: | lrit1a / 553943 | ZFINID: | ZDB-GENE-040924-5 | Length: | 643 | Species: | Danio rerio |
| Alignment Length: | 362 | Identity: | 83/362 - (22%) |
|---|---|---|---|
| Similarity: | 124/362 - (34%) | Gaps: | 126/362 - (34%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 85 ILTIHRHVISRIP------RYSITYTD--------------NTWL----------------LHVN 113
Fly 114 QAHQDDRGYYMCQVNTNPMISQVGYLQV---VVPPNILD----------------IESTPSSVAV 159
Fly 160 RENQNINMTCRADGFPAPKIIWRREDGE----EIAVEKKKKVLVYDADVLPLTKVSRNEMGAYLC 220
Fly 221 IATN--GVPPSVSKRIILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYWVYNSVMVL 283
Fly 284 PSKK----YKTDYTENSYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIPLPSTPSK 344
Fly 345 QVTHTTVESR--------ENNIIPSSRNDTTKSLQTD 373 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| DIP-delta | NP_001097508.2 | IG | 51..143 | CDD:214652 | 23/96 (24%) |
| Ig | 145..238 | CDD:416386 | 29/114 (25%) | ||
| Ig strand A | 145..149 | CDD:409353 | 1/3 (33%) | ||
| Ig strand A' | 154..159 | CDD:409353 | 1/4 (25%) | ||
| Ig strand B | 165..172 | CDD:409353 | 1/6 (17%) | ||
| Ig strand C | 178..183 | CDD:409353 | 1/4 (25%) | ||
| Ig strand C' | 185..187 | CDD:409353 | 1/1 (100%) | ||
| Ig strand D | 195..199 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 203..209 | CDD:409353 | 1/5 (20%) | ||
| Ig strand F | 216..223 | CDD:409353 | 3/6 (50%) | ||
| Ig strand G | 230..238 | CDD:409353 | 3/7 (43%) | ||
| Ig | 242..333 | CDD:416386 | 18/94 (19%) | ||
| Ig strand A' | 250..253 | CDD:409353 | 0/2 (0%) | ||
| Ig strand B | 259..266 | CDD:409353 | 2/6 (33%) | ||
| Ig strand C | 272..277 | CDD:409353 | 0/4 (0%) | ||
| Ig strand C' | 281..283 | CDD:409353 | 0/1 (0%) | ||
| Ig strand D | 289..293 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 295..305 | CDD:409353 | 0/9 (0%) | ||
| Ig strand F | 314..322 | CDD:409353 | 0/7 (0%) | ||
| Ig strand G | 325..334 | CDD:409353 | 1/8 (13%) | ||
| lrit1a | NP_001018174.2 | leucine-rich repeat | 61..84 | CDD:275378 | |
| LRR_8 | 63..119 | CDD:290566 | |||
| LRR_RI | <77..175 | CDD:238064 | 9/39 (23%) | ||
| leucine-rich repeat | 85..108 | CDD:275378 | |||
| LRR_8 | 108..167 | CDD:290566 | 9/31 (29%) | ||
| leucine-rich repeat | 109..132 | CDD:275378 | |||
| leucine-rich repeat | 133..156 | CDD:275378 | 5/20 (25%) | ||
| leucine-rich repeat | 157..170 | CDD:275378 | 4/12 (33%) | ||
| LRRCT | 199..243 | CDD:214507 | 10/44 (23%) | ||
| I-set | 252..343 | CDD:254352 | 25/92 (27%) | ||
| Ig | 259..333 | CDD:299845 | 23/75 (31%) | ||
| fn3 | 448..515 | CDD:278470 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||