DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and igsf9b

DIOPT Version :9

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:XP_686205.6 Gene:igsf9b / 553348 ZFINID:ZDB-GENE-060810-28 Length:2021 Species:Danio rerio


Alignment Length:430 Identity:104/430 - (24%)
Similarity:164/430 - (38%) Gaps:88/430 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 NVTVAVGRD------ANLPCVVEHLGGYK-----------------------VAWIHIDRQMILT 87
            ||:|||...      :..|.|...:||:.                       |.|:.:...:.:.
Zfish    10 NVSVAVALSLLRLTLSTEPVVQGRVGGFAELGCSLTPPSEGATTPNLFPLHVVEWVRLGYNVPIL 74

  Fly    88 IHRHVISRIPRYSITYTDNTWL-----LHVNQAHQDDRGYYMCQVNTNPMIS---QVG---YLQV 141
            |  ...|..||....|.....|     |.|.:...:|.|::.|::......|   |.|   :|.:
Zfish    75 I--KFGSYTPRVHPNYKGRVSLSRGASLMVEKLTLEDEGWFECRILLLDRTSDEFQNGTWNFLSI 137

  Fly   142 VVPPNILDIESTPSSVAVRENQNINMTCRADGFPAPKIIWRREDGEEIAVEKKKKVLVYDADVLP 206
            ..||  :.|::.|..:.|...:::.:.|.|.|.|.|.||||:...   |.||::::.|.: :.|.
Zfish   138 TAPP--VFIKTPPPFLEVLLGESLTLHCDAHGNPKPTIIWRKYLS---AAEKQEEIQVLN-ETLS 196

  Fly   207 LTKVSRNEMGAYLCIATNGVPPSVSKRIILDVEFSPMIWVPNQLVGAPSGT------DVTIDCHT 265
            |:||:|...|.|.|..:|. ..:::....|.|:..|:|.:      ||..|      |..:.|..
Zfish   197 LSKVTRETAGIYKCHVSNS-EGNLTHSTQLQVKGPPIIII------APEDTTMNMSQDAVLQCQA 254

  Fly   266 EAHPKAIIY--W-----VYNSVMVLPSK-KYKTDYTENSYRAHMKLTIRNLQYGDFGNYRCISKN 322
            ||:|..:.|  |     ||: :.:|.|: |...|.|         |.|..|...|.|||.|...|
Zfish   255 EAYPSNLTYEWWKQGQNVYH-IEILKSRVKILVDGT---------LLISALIPDDSGNYTCRPTN 309

  Fly   323 SLGETEGSIRVYEIPLPSTPSKQVTHTTVESRENNIIPSSRNDTTKSLQ---TDVGYAMKNDLYP 384
            .|.....:.....:..|:...:....|.:.......||.........|.   |..|.::..:.||
Zfish   310 GLMTPPAASAYLTVKHPARVVRMPRETYLPMGMGGKIPCPVQAEPPMLYVNWTKDGASLNLEQYP 374

  Fly   385 G-SASSSSSGGSSSAASSSSSMQTSALPGGVAGNSLSSMG 423
            | ..:|..|...::|...:..|.|.     .|.||..:||
Zfish   375 GWMVNSEGSVFITAANDDAVGMYTC-----TAYNSYGTMG 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 26/130 (20%)
Ig 145..238 CDD:416386 27/92 (29%)
Ig strand A 145..149 CDD:409353 1/3 (33%)
Ig strand A' 154..159 CDD:409353 1/4 (25%)
Ig strand B 165..172 CDD:409353 1/6 (17%)
Ig strand C 178..183 CDD:409353 3/4 (75%)
Ig strand C' 185..187 CDD:409353 0/1 (0%)
Ig strand D 195..199 CDD:409353 0/3 (0%)
Ig strand E 203..209 CDD:409353 2/5 (40%)
Ig strand F 216..223 CDD:409353 3/6 (50%)
Ig strand G 230..238 CDD:409353 1/7 (14%)
Ig 242..333 CDD:416386 29/104 (28%)
Ig strand A' 250..253 CDD:409353 0/2 (0%)
Ig strand B 259..266 CDD:409353 1/6 (17%)
Ig strand C 272..277 CDD:409353 2/11 (18%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 1/3 (33%)
Ig strand E 295..305 CDD:409353 1/9 (11%)
Ig strand F 314..322 CDD:409353 4/7 (57%)
Ig strand G 325..334 CDD:409353 0/8 (0%)
igsf9bXP_686205.6 Ig 27..132 CDD:299845 20/106 (19%)
IG_like 148..227 CDD:214653 25/83 (30%)
IGc2 156..217 CDD:197706 22/65 (34%)
Ig 237..323 CDD:299845 26/95 (27%)
IG_like 237..323 CDD:214653 26/95 (27%)
Ig 345..411 CDD:143165 18/70 (26%)
IG_like 435..507 CDD:214653
IGc2 437..496 CDD:197706
FN3 512..603 CDD:238020
FN3 621..709 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.