DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and Hmcn1

DIOPT Version :10

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:XP_006529820.1 Gene:Hmcn1 / 545370 MGIID:2685047 Length:5658 Species:Mus musculus


Alignment Length:550 Identity:129/550 - (23%)
Similarity:181/550 - (32%) Gaps:184/550 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KLLLIALNIFPSRFTNRRIMFLIYMTNLVTHVMMDEPRFAQPIPNVTVAVGRDANLPCVVEHLGG 72
            :.|.:|.|:   ..|:||      ..:|..||   .|..|....||||.|.....|.|  |..| 
Mouse  3803 RYLCMATNV---AGTDRR------RIDLQVHV---PPSIAMGPTNVTVTVNVQTTLAC--EATG- 3852

  Fly    73 YKVAWIHIDRQMILTIHRHVISRIPRYSITYTDNTWLLHVNQAHQ-----------------DDR 120
                                   ||:.|:|:..|..||:|:|...                 ||.
Mouse  3853 -----------------------IPKPSVTWRKNGHLLNVDQNQNSYRLLSSGSLVIISPSVDDT 3894

  Fly   121 GYYMCQVNTNPMISQVGY------LQVVVPPNILDIESTPSSVAVRENQNINMTCRADGFPAPKI 179
            ..|.|.|.     |..|.      |.|.|||.|.|   .|....|.......|||.|.|.|.|.|
Mouse  3895 ASYECTVT-----SDAGEDKRAVDLTVQVPPTIAD---EPMDFLVTRQAPAVMTCSASGVPVPSI 3951

  Fly   180 IWR--------REDGEEIAVEKKKKVLVYDADVLPLTKVSRNEMGAYLCIATNGVPPSVSKRIIL 236
            .|.        |.||        .::|...|..:|.|::  |..|.|.|:|.|.. .|..:.:.|
Mouse  3952 HWTKNGLRLLPRGDG--------YRILSSGAIEIPTTQL--NHAGRYTCVARNAA-GSAHRHVTL 4005

  Fly   237 DVEFSPMIWVPNQLVGAPSGTDVTID------CHTEAHPKAIIYWVYNSVMVLPSKKYKTDYTEN 295
            .|:..|:| .|.     ||..||.::      |.....|...|.|....:.|:.|.|........
Mouse  4006 RVQEPPVI-QPQ-----PSELDVILNNPILLPCEATGIPTPFITWQKEGINVITSGKSLAILPSG 4064

  Fly   296 SYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRV-YEIP---------------------- 337
            |      |.|.....||.|.|.|:::|..|...|.::: .::|                      
Mouse  4065 S------LQISRAVRGDAGTYMCVAQNPAGTALGKVKLNVQVPPVISSHQKEYVVTMDKPVSLLC 4123

  Fly   338 -LPSTPSKQVT-----HTTVESRENNIIPSSRNDTTKSLQTDVGYAMKNDLYPGSASSSSSGGSS 396
             ...:|...:|     |...||....|:.|.      :||  :.:|..:|....:..:::..|||
Mouse  4124 ETEGSPPPDITWHKDGHALTESIRQRILNSG------ALQ--IAFAQPDDAGQYTCMAANMAGSS 4180

  Fly   397 SAASSSSSMQTSALPGGVAGNSLSSMGSKGSLAI--------------------------GKSTF 435
            |.    ||..|..:|..:....:....::.|.|:                          ||   
Mouse  4181 SV----SSTLTVHVPPRIQSTEVHFTVNENSQAVLPCVADGIPTPAIHWEKDGVLIANLLGK--- 4238

  Fly   436 YTERPPNEYAASSVAGLLLHRALLFGSGIY 465
            ||.:|..|        |:|...:|..||.|
Mouse  4239 YTAQPYGE--------LILENVVLEDSGTY 4260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG_like 51..143 CDD:214653 27/114 (24%)
Ig strand B 61..65 CDD:409353 1/3 (33%)
Ig strand C 74..78 CDD:409353 0/3 (0%)
Ig strand E 105..112 CDD:409353 3/6 (50%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 134..137 CDD:409353 1/2 (50%)
Ig 145..238 CDD:472250 29/100 (29%)
Ig strand B 165..169 CDD:409353 1/3 (33%)
Ig strand C 178..182 CDD:409353 1/3 (33%)
Ig strand E 203..207 CDD:409353 0/3 (0%)
Ig strand F 217..222 CDD:409353 2/4 (50%)
Ig strand G 231..234 CDD:409353 0/2 (0%)
Ig 242..333 CDD:472250 25/96 (26%)
Ig strand B 259..263 CDD:409353 1/9 (11%)
Ig strand C 272..276 CDD:409353 1/3 (33%)
Ig strand E 295..305 CDD:409353 2/9 (22%)
Ig strand F 315..320 CDD:409353 2/4 (50%)
Ig strand G 328..331 CDD:409353 1/2 (50%)
Hmcn1XP_006529820.1 ChlD <30..210 CDD:440853
Ig 520..608 CDD:472250
Ig strand B 537..541 CDD:409544
Ig strand C 550..554 CDD:409544
Ig strand E 574..578 CDD:409544
Ig strand F 588..593 CDD:409544
Ig strand G 601..604 CDD:409544
Ig_3 611..685 CDD:464046
I-set 702..789 CDD:400151
Ig strand B 719..723 CDD:409405
Ig strand C 732..736 CDD:409405
Ig strand E 755..759 CDD:409405
Ig strand F 769..774 CDD:409405
Ig strand G 782..785 CDD:409405
Ig 793..884 CDD:472250
Ig strand B 810..814 CDD:409353
Ig strand C 823..829 CDD:409353
Ig strand E 850..854 CDD:409353
Ig strand F 864..869 CDD:409353
Ig strand G 877..880 CDD:409353
Ig 890..977 CDD:472250
Ig strand B 907..911 CDD:409389
Ig strand C 921..925 CDD:409389
Ig strand E 943..947 CDD:409389
Ig strand F 957..962 CDD:409389
Ig 980..1071 CDD:472250
Ig strand B 998..1002 CDD:409353
Ig strand C 1011..1015 CDD:409353
Ig strand E 1035..1038 CDD:409353
Ig strand F 1048..1053 CDD:409353
Ig strand G 1061..1064 CDD:409353
I-set 1085..1167 CDD:400151
Ig strand B 1097..1101 CDD:409544
Ig strand C 1110..1114 CDD:409544
Ig strand E 1133..1137 CDD:409544
Ig strand F 1147..1152 CDD:409544
Ig strand G 1160..1163 CDD:409544
I-set 1171..1257 CDD:400151
Ig strand B 1188..1192 CDD:409353
Ig strand C 1201..1205 CDD:409353
Ig strand E 1223..1227 CDD:409353
Ig strand F 1237..1242 CDD:409353
Ig strand G 1250..1253 CDD:409353
Ig 1261..1354 CDD:472250
Ig strand B 1283..1287 CDD:409353
Ig strand C 1296..1300 CDD:409353
Ig strand E 1319..1323 CDD:409353
Ig strand F 1334..1339 CDD:409353
Ig strand G 1347..1350 CDD:409353
I-set 1368..1447 CDD:400151
Ig strand B 1377..1381 CDD:409353
Ig strand C 1390..1394 CDD:409353
Ig strand E 1413..1417 CDD:409353
Ig strand F 1427..1432 CDD:409353
IG_like 1459..1541 CDD:214653
Ig strand B 1470..1474 CDD:409544
Ig strand C 1483..1487 CDD:409544
Ig strand E 1506..1511 CDD:409544
Ig strand F 1521..1526 CDD:409544
Ig strand G 1534..1537 CDD:409544
Ig 1564..1632 CDD:472250
Ig strand B 1564..1568 CDD:409353
Ig strand C 1577..1581 CDD:409353
Ig strand E 1600..1604 CDD:409353
Ig strand F 1614..1619 CDD:409353
I-set 1644..1728 CDD:400151
Ig strand B 1658..1662 CDD:409389
Ig strand C 1671..1675 CDD:409389
Ig strand E 1693..1698 CDD:409389
Ig strand F 1708..1713 CDD:409389
I-set 1751..1821 CDD:400151
Ig strand B 1752..1755 CDD:409353
Ig strand C 1764..1768 CDD:409353
Ig strand E 1786..1791 CDD:409353
Ig strand F 1801..1806 CDD:409353
Ig strand G 1814..1817 CDD:409353
IG_like 1833..1938 CDD:214653
Ig strand B 1843..1847 CDD:409353
Ig strand C 1856..1860 CDD:409353
Ig strand E 1886..1908 CDD:409353
Ig strand F 1918..1923 CDD:409353
Ig strand G 1931..1934 CDD:409353
Ig 1952..2023 CDD:472250
Ig strand B 1961..1965 CDD:409544
Ig strand C 1974..1978 CDD:409544
Ig strand E 1997..2001 CDD:409544
Ig strand F 2011..2016 CDD:409544
Ig 2044..2115 CDD:472250
Ig strand B 2052..2056 CDD:409389
Ig strand C 2065..2069 CDD:409389
Ig strand E 2088..2093 CDD:409389
Ig strand F 2103..2108 CDD:409389
I-set 2134..2214 CDD:400151
Ig strand B 2144..2148 CDD:409353
Ig strand C 2157..2161 CDD:409353
Ig strand E 2179..2184 CDD:409353
Ig strand F 2194..2199 CDD:409353
Ig strand G 2207..2210 CDD:409353
I-set 2226..2309 CDD:400151
Ig strand B 2237..2241 CDD:409405
Ig strand C 2250..2254 CDD:409405
Ig strand E 2276..2279 CDD:409405
Ig strand F 2289..2294 CDD:409405
Ig strand G 2304..2307 CDD:409405
Ig_3 2312..2390 CDD:464046
Ig strand B 2427..2431 CDD:409353
Ig <2429..2497 CDD:472250
Ig strand C 2440..2444 CDD:409353
Ig strand E 2461..2467 CDD:409353
Ig strand F 2477..2482 CDD:409353
I-set 2501..2590 CDD:400151
Ig strand B 2520..2524 CDD:409562
Ig strand C 2533..2537 CDD:409562
Ig strand E 2556..2560 CDD:409562
Ig strand F 2570..2575 CDD:409562
Ig strand G 2583..2586 CDD:409562
I-set 2605..2686 CDD:400151
Ig strand B 2617..2620 CDD:409353
Ig strand C 2629..2633 CDD:409353
Ig strand E 2652..2656 CDD:409353
Ig strand F 2666..2671 CDD:409353
I-set 2704..2785 CDD:400151
Ig strand B 2715..2719 CDD:409544
Ig strand C 2728..2732 CDD:409544
Ig strand E 2750..2755 CDD:409544
Ig strand F 2765..2770 CDD:409544
I-set 2812..2881 CDD:400151
Ig strand B 2818..2822 CDD:409353
Ig strand C 2831..2835 CDD:409353
Ig strand E 2854..2858 CDD:409353
Ig strand F 2868..2873 CDD:409353
I-set 2902..2983 CDD:400151
Ig strand B 2913..2917 CDD:409544
Ig strand C 2926..2930 CDD:409544
Ig strand E 2948..2953 CDD:409544
Ig strand F 2963..2968 CDD:409544
I-set 3005..3075 CDD:400151
Ig strand B 3005..3009 CDD:409353
Ig strand C 3018..3022 CDD:409353
Ig strand E 3041..3045 CDD:409353
Ig strand F 3055..3060 CDD:409353
Ig strand G 3068..3071 CDD:409353
I-set 3087..3170 CDD:400151
Ig strand B 3100..3104 CDD:409562
Ig strand C 3113..3117 CDD:409562
Ig strand E 3136..3140 CDD:409562
Ig strand F 3150..3155 CDD:409562
Ig strand G 3163..3166 CDD:409562
Ig_3 3173..3251 CDD:464046
Ig 3267..3361 CDD:472250
Ig strand B 3287..3291 CDD:409353
Ig strand C 3300..3304 CDD:409353
Ig strand E 3325..3329 CDD:409353
Ig strand F 3339..3344 CDD:409353
Ig strand G 3352..3355 CDD:409353
I-set 3377..3453 CDD:400151
Ig strand B 3383..3387 CDD:409562
Ig strand C 3396..3400 CDD:409562
Ig strand E 3419..3423 CDD:409562
Ig strand F 3433..3438 CDD:409562
Ig strand G 3446..3449 CDD:409562
I-set 3468..3546 CDD:400151
Ig strand B 3476..3480 CDD:409544
Ig strand C 3489..3493 CDD:409544
Ig strand E 3511..3516 CDD:409544
Ig strand F 3526..3531 CDD:409544
Ig strand G 3539..3542 CDD:409544
Ig 3556..3629 CDD:472250
Ig strand B 3569..3573 CDD:409544
Ig strand C 3582..3586 CDD:409544
Ig strand E 3604..3609 CDD:409544
Ig strand F 3619..3624 CDD:409544
I-set 3652..3732 CDD:400151
Ig strand B 3662..3666 CDD:409353
Ig strand C 3675..3679 CDD:409353
Ig strand E 3698..3702 CDD:409353
Ig strand F 3712..3717 CDD:409353
I-set 3736..3823 CDD:400151 7/28 (25%)
Ig strand B 3753..3757 CDD:409544
Ig strand C 3766..3770 CDD:409544
Ig strand E 3789..3793 CDD:409544
Ig strand F 3803..3808 CDD:409544 1/4 (25%)
Ig 3846..3907 CDD:409353 19/91 (21%)
Ig strand C 3857..3861 CDD:409353 2/3 (67%)
Ig strand E 3882..3886 CDD:409353 0/3 (0%)
Ig strand F 3896..3901 CDD:409353 2/4 (50%)
Ig 3922..4007 CDD:472250 28/98 (29%)
Ig strand B 3937..3941 CDD:409544 1/3 (33%)
Ig strand C 3950..3954 CDD:409544 1/3 (33%)
Ig strand E 3973..3977 CDD:409544 1/3 (33%)
Ig strand F 3987..3992 CDD:409544 2/4 (50%)
Ig strand G 4000..4003 CDD:409544 0/2 (0%)
Ig_3 4010..4085 CDD:464046 22/86 (26%)
Ig_3 4101..4175 CDD:464046 12/81 (15%)
Ig_3 4191..4266 CDD:464046 14/80 (18%)
I-set 4283..4368 CDD:400151
Ig strand B 4300..4304 CDD:409405
Ig strand C 4313..4317 CDD:409405
Ig strand E 4334..4338 CDD:409405
Ig strand F 4348..4353 CDD:409405
Ig 4379..4458 CDD:472250
Ig strand B 4390..4394 CDD:409390
Ig strand C 4403..4407 CDD:409390
Ig strand E 4425..4429 CDD:409390
Ig strand F 4439..4444 CDD:409390
Ig strand G 4452..4455 CDD:409390
Ig 4464..4549 CDD:472250
Ig strand B 4480..4484 CDD:409544
Ig strand C 4493..4497 CDD:409544
Ig strand E 4515..4519 CDD:409544
Ig strand F 4529..4534 CDD:409544
Ig strand G 4542..4545 CDD:409544
TSP1 4556..4607 CDD:214559
TSP1 4612..4664 CDD:214559
TSP1 4669..4721 CDD:214559
TSP1 4726..4778 CDD:214559
TSP1 4783..4835 CDD:214559
TSP1 4840..4892 CDD:214559
G2F 4891..5115 CDD:214774
EGF_CA 5130..5169 CDD:214542
EGF_CA 5170..5197 CDD:429571
EGF_CA 5215..5252 CDD:214542
EGF_CA 5253..5286 CDD:238011
EGF_CA 5295..5326 CDD:429571
EGF_CA 5338..5377 CDD:214542
EGF_CA 5455..5494 CDD:214542
EGF_CA 5495..5531 CDD:214542
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.