DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and dpr12

DIOPT Version :9

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster


Alignment Length:224 Identity:57/224 - (25%)
Similarity:91/224 - (40%) Gaps:54/224 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 DEPRFAQP---IPNVTVAVGRDANLPCV---VEHLG--GYKVAWIHIDRQMILTIHRHVISRIPR 98
            |.|.|...   ..|.||.:|..|.|.|.   |:.:|  ..:::||......||:....:.:...|
  Fly    73 DSPMFEDSELMAHNTTVQLGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDER 137

  Fly    99 YSITYT--DNTWLLHVNQAHQDDRGYYMCQVNT-NPMISQVGYLQVVVPPNIL--------DIES 152
            ::|.:|  .|.|.|.:....:.|.|.|.|||:| ..:||....||||||...:        |:.|
  Fly   138 FAILHTPGSNMWTLQIKFVQRRDHGMYECQVSTPTGIISHFVNLQVVVPEAFILGSGELHVDMGS 202

  Fly   153 TPSSVAVRENQNINMTCRADGFPAPK--IIWRRED--------GEEIAVE------KKKKVLVYD 201
            |           ||:.|..:..|.|.  :.|::.|        ..:|.:|      .:.::::.:
  Fly   203 T-----------INLVCIIEKSPTPPQYVYWQKNDRLINYVDSRRDITIETTPGPRTQSRLIIRE 256

  Fly   202 ADVLPLTKVSRNEMGAYLCIATNGVPPSV 230
            ..|        .:.|.|.|.|:|..|.|:
  Fly   257 PQV--------TDSGNYTCSASNTEPASI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 31/99 (31%)
Ig 145..238 CDD:416386 20/110 (18%)
Ig strand A 145..149 CDD:409353 0/11 (0%)
Ig strand A' 154..159 CDD:409353 0/4 (0%)
Ig strand B 165..172 CDD:409353 3/6 (50%)
Ig strand C 178..183 CDD:409353 1/6 (17%)
Ig strand C' 185..187 CDD:409353 1/9 (11%)
Ig strand D 195..199 CDD:409353 0/3 (0%)
Ig strand E 203..209 CDD:409353 1/5 (20%)
Ig strand F 216..223 CDD:409353 3/6 (50%)
Ig strand G 230..238 CDD:409353 0/1 (0%)
Ig 242..333 CDD:416386
Ig strand A' 250..253 CDD:409353
Ig strand B 259..266 CDD:409353
Ig strand C 272..277 CDD:409353
Ig strand C' 281..283 CDD:409353
Ig strand D 289..293 CDD:409353
Ig strand E 295..305 CDD:409353
Ig strand F 314..322 CDD:409353
Ig strand G 325..334 CDD:409353
dpr12NP_652462.3 IG 86..183 CDD:214652 29/96 (30%)
Ig_3 193..271 CDD:404760 17/96 (18%)
Ig strand B 204..208 CDD:409353 2/3 (67%)
Ig strand C 219..223 CDD:409353 0/3 (0%)
Ig strand E 250..254 CDD:409353 0/3 (0%)
Ig strand F 264..269 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.