DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and dpr6

DIOPT Version :9

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster


Alignment Length:365 Identity:89/365 - (24%)
Similarity:130/365 - (35%) Gaps:83/365 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TNLVTHVMMDEPRFAQPIP-NVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISRI 96
            |...||....||.|....| |||..:|:.|.|.|.|.:|....|:||......|||:..:..:..
  Fly    62 TAAYTHPKWMEPYFDPSTPRNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSD 126

  Fly    97 PRYSITYTDNT--WLLHVNQAHQDDRGYYMCQVNTNPMISQVGYLQVVVPPNILDIESTPSSVAV 159
            .|:..|:..:|  |.|.:..|.:.|.|.|.||::|.|:.|....|.||||  ...|...| .:.|
  Fly   127 QRFQATHHQDTEDWTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNVVVP--TATILGGP-DLHV 188

  Fly   160 RENQNINMTCRADGFPAPK--IIWRRED----------GEEIAVEK----KKKVLVYDADVLPLT 208
            .:...||:||.....|.|.  |.|...:          |..:..||    ...:|:.:||:.   
  Fly   189 DKGSTINLTCTVKFSPEPPAYIFWYHHEEVINYDSSRGGVSVITEKGDVTTSFLLIQNADLA--- 250

  Fly   209 KVSRNEMGAYLCIATNGVPPSVSKRIILDVEFSPMIWVPNQLVGAPSGTDV-TIDCHTEAHPKAI 272
                 :.|.|.|                                |||..|| ::..|        
  Fly   251 -----DSGKYSC--------------------------------APSNADVASVRVH-------- 270

  Fly   273 IYWVYNSVMVLPSKKYKTDYTENSYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIP 337
               |.|...::..:..:...|.:|...:..|||..|    .|...|.|.........:.....:|
  Fly   271 ---VLNVRAIISGEHPEAMQTGSSGCQYNWLTIVLL----LGLVLCYSSQQCSSAVPASLTSSLP 328

  Fly   338 LPS---TPSKQVTHTTV--ESRENNIIPSSRNDTTKSLQT 372
            |||   .|:.....||.  ||..:..:.::|.....:..|
  Fly   329 LPSQLPLPAAAAATTTATGESASSESVTAARASAATTTTT 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 32/94 (34%)
Ig 145..238 CDD:416386 20/108 (19%)
Ig strand A 145..149 CDD:409353 0/3 (0%)
Ig strand A' 154..159 CDD:409353 1/4 (25%)
Ig strand B 165..172 CDD:409353 4/6 (67%)
Ig strand C 178..183 CDD:409353 2/6 (33%)
Ig strand C' 185..187 CDD:409353 0/11 (0%)
Ig strand D 195..199 CDD:409353 0/3 (0%)
Ig strand E 203..209 CDD:409353 1/5 (20%)
Ig strand F 216..223 CDD:409353 3/6 (50%)
Ig strand G 230..238 CDD:409353 0/7 (0%)
Ig 242..333 CDD:416386 17/91 (19%)
Ig strand A' 250..253 CDD:409353 0/2 (0%)
Ig strand B 259..266 CDD:409353 2/7 (29%)
Ig strand C 272..277 CDD:409353 0/4 (0%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 0/3 (0%)
Ig strand E 295..305 CDD:409353 2/9 (22%)
Ig strand F 314..322 CDD:409353 3/7 (43%)
Ig strand G 325..334 CDD:409353 0/8 (0%)
dpr6NP_001287018.1 V-set 79..174 CDD:284989 31/94 (33%)
IG_like 80..175 CDD:214653 32/94 (34%)
IG_like 184..271 CDD:214653 25/138 (18%)
IGc2 191..262 CDD:197706 20/110 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.