DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and OPCML

DIOPT Version :10

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001306032.1 Gene:OPCML / 4978 HGNCID:8143 Length:354 Species:Homo sapiens


Alignment Length:328 Identity:96/328 - (29%)
Similarity:146/328 - (44%) Gaps:33/328 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RIMFLIYMTNLVTHVMMDEPRFAQPIPNVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIH 89
            |::||: .|.:  .|...:..|.:.:.||||..|..|.|.|.::. ...:|||  ::|..||...
Human    20 RLLFLV-PTGV--PVRSGDATFPKAMDNVTVRQGESATLRCTIDD-RVTRVAW--LNRSTILYAG 78

  Fly    90 RHVISRIPRYSI-TYTDNTWLLHVNQAHQDDRGYYMCQVNT--NPMISQVGYLQVVVPPNILDIE 151
            ....|..||..| ..|...:.:.:......|.|.|.|.|.|  :|..|:| :|.|.|||.|::|.
Human    79 NDKWSIDPRVIILVNTPTQYSIMIQNVDVYDEGPYTCSVQTDNHPKTSRV-HLIVQVPPQIMNIS 142

  Fly   152 STPSSVAVRENQNINMTCRADGFPAPKIIWRREDGEEIAVEKKKKVLVYDADVLPLTKVSRNEMG 216
               |.:.|.|..::.:.|.|.|.|.|.:.||     .::| |:.:..|.:.:.|.::.:.|::.|
Human   143 ---SDITVNEGSSVTLLCLAIGRPEPTVTWR-----HLSV-KEGQGFVSEDEYLEISDIKRDQSG 198

  Fly   217 AYLCIATNGVPPSVSKRIILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYWVYNSVM 281
            .|.|.|.|.|.....:::.:.|.:.|.|..... .|...|....:.|...|.|.|...|......
Human   199 EYECSALNDVAAPDVRKVKITVNYPPYISKAKN-TGVSVGQKGILSCEASAVPMAEFQWFKEETR 262

  Fly   282 V---LPSKKYKTDYTENSYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIPLPSTPS 343
            :   |...:     .||..|. ..||..|:...|:|||.|::.|.||.|..||.:|||    :||
Human   263 LATGLDGMR-----IENKGRM-STLTFFNVSEKDYGNYTCVATNKLGNTNASITLYEI----SPS 317

  Fly   344 KQV 346
            ..|
Human   318 SAV 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG_like 51..143 CDD:214653 30/94 (32%)
Ig strand B 61..65 CDD:409353 2/3 (67%)
Ig strand C 74..78 CDD:409353 2/3 (67%)
Ig strand E 105..112 CDD:409353 0/6 (0%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 134..137 CDD:409353 1/2 (50%)
Ig 145..238 CDD:472250 24/92 (26%)
Ig strand B 165..169 CDD:409353 0/3 (0%)
Ig strand C 178..182 CDD:409353 0/3 (0%)
Ig strand E 203..207 CDD:409353 1/3 (33%)
Ig strand F 217..222 CDD:409353 2/4 (50%)
Ig strand G 231..234 CDD:409353 0/2 (0%)
Ig 242..333 CDD:472250 27/93 (29%)
Ig strand B 259..263 CDD:409353 0/3 (0%)
Ig strand C 272..276 CDD:409353 0/3 (0%)
Ig strand E 295..305 CDD:409353 3/9 (33%)
Ig strand F 315..320 CDD:409353 3/4 (75%)
Ig strand G 328..331 CDD:409353 0/2 (0%)
OPCMLNP_001306032.1 Ig 44..132 CDD:472250 29/91 (32%)
Ig strand B 53..57 CDD:409353 2/3 (67%)
Ig strand C 65..69 CDD:409353 3/5 (60%)
Ig strand E 98..102 CDD:409353 0/3 (0%)
Ig strand F 112..117 CDD:409353 2/4 (50%)
Ig strand G 125..128 CDD:409353 1/2 (50%)
Ig_3 135..206 CDD:464046 23/79 (29%)
Ig 224..312 CDD:472250 27/94 (29%)
Ig strand B 240..244 CDD:409353 0/3 (0%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 279..283 CDD:409353 1/3 (33%)
Ig strand F 293..298 CDD:409353 3/4 (75%)
Ig strand G 306..309 CDD:409353 0/2 (0%)

Return to query results.
Submit another query.