DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and NCAM2

DIOPT Version :10

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:XP_011527877.1 Gene:NCAM2 / 4685 HGNCID:7657 Length:874 Species:Homo sapiens


Alignment Length:457 Identity:102/457 - (22%)
Similarity:171/457 - (37%) Gaps:90/457 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LIYMTNLVTHVMMDEPRFAQPIPNVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVI 93
            :|.:.|:...:.|.:..|     |.|...|.:....|.........::|..         :..:|
Human   226 IIVIVNVPPAISMPQKSF-----NATAERGEEMTFSCRASGSPEPAISWFR---------NGKLI 276

  Fly    94 SRIPRYSITYTDNTWLLHVNQAHQDDRGYYMCQ-VNTNPMISQVGYLQVVVPPNILDIESTPSSV 157
            ....:| |....||.|. |......|.|.|:|: .|......:..:|||.|.|:|:.:::.    
Human   277 EENEKY-ILKGSNTELT-VRNIINSDGGPYVCRATNKAGEDEKQAFLQVFVQPHIIQLKNE---- 335

  Fly   158 AVRENQNINMTCRADGFPAPKIIWRRE-------------DGEEIAVEKKKKVLVYDADVLPLTK 209
            ...||..:.:.|.|:|.|.|:|.|:|.             ||.   :|.|.:   :.:..|.:..
Human   336 TTYENGQVTLVCDAEGEPIPEITWKRAVDGFTFTEGDKSLDGR---IEVKGQ---HGSSSLHIKD 394

  Fly   210 VSRNEMGAYLCIATNGVPPSVSKRIILDVEFSPMIWVPNQLV-GAPSGTDVTIDCHTEAHPKAII 273
            |..::.|.|.|.|.:.: ....|.:.||:|::|. ::.||.: .:..|..:.|.|..:::|.|.|
Human   395 VKLSDSGRYDCEAASRI-GGHQKSMYLDIEYAPK-FISNQTIYYSWEGNPINISCDVKSNPPASI 457

  Fly   274 YWVYNSVMVLPSKKYKTDYTENSYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIPL 338
            :| ....:|||:|. .|:....|....|.|.|......|||.|.|.:.|.:|.   ..:.|.:.|
Human   458 HW-RRDKLVLPAKN-TTNLKTYSTGRKMILEIAPTSDNDFGRYNCTATNHIGT---RFQEYILAL 517

  Fly   339 PSTPSK-------QVTHTTVESRENNIIPSSRNDT-TKSLQTDVGYAMKNDLYPGSASSSSSGGS 395
            ...||.       :::.||.:...|.  |.|.... ....|.||                     
Human   518 ADVPSSPYGVKIIELSQTTAKVSFNK--PDSHGGVPIHHYQVDV--------------------- 559

  Fly   396 SSAASS------SSSMQTSALPGGVAGNS-----LSSMGSKGSLAIGKSTFYTERPPNEYAASSV 449
            ...||.      |..:||..:...:..|:     ::::..||.....|...:...|..|.:..|:
Human   560 KEVASEIWKIVRSHGVQTMVVLNNLEPNTTYEIRVAAVNGKGQGDYSKIEIFQTLPVREPSPPSI 624

  Fly   450 AG 451
            .|
Human   625 HG 626

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG_like 51..143 CDD:214653 20/92 (22%)
Ig strand B 61..65 CDD:409353 0/3 (0%)
Ig strand C 74..78 CDD:409353 0/3 (0%)
Ig strand E 105..112 CDD:409353 3/6 (50%)
Ig strand F 122..127 CDD:409353 2/5 (40%)
Ig strand G 134..137 CDD:409353 0/2 (0%)
Ig 145..238 CDD:472250 24/105 (23%)
Ig strand B 165..169 CDD:409353 0/3 (0%)
Ig strand C 178..182 CDD:409353 1/3 (33%)
Ig strand E 203..207 CDD:409353 1/3 (33%)
Ig strand F 217..222 CDD:409353 2/4 (50%)
Ig strand G 231..234 CDD:409353 1/2 (50%)
Ig 242..333 CDD:472250 26/91 (29%)
Ig strand B 259..263 CDD:409353 1/3 (33%)
Ig strand C 272..276 CDD:409353 1/3 (33%)
Ig strand E 295..305 CDD:409353 3/9 (33%)
Ig strand F 315..320 CDD:409353 2/4 (50%)
Ig strand G 328..331 CDD:409353 0/2 (0%)
NCAM2XP_011527877.1 IgI_1_NCAM-2 46..138 CDD:409452
Ig strand A 46..51 CDD:409452
Ig strand A' 54..58 CDD:409452
Ig strand B 60..70 CDD:409452
Ig strand C 74..80 CDD:409452
Ig strand C' 83..85 CDD:409452
Ig strand D 91..97 CDD:409452
Ig strand E 99..107 CDD:409452
Ig strand F 114..121 CDD:409452
Ig strand G 126..137 CDD:409452
Ig 142..218 CDD:472250
Ig strand C 170..174 CDD:409353
Ig strand E 193..197 CDD:409353
IgI_1_MuSK 234..323 CDD:409562 20/104 (19%)
Ig strand A 234..237 CDD:409562 0/2 (0%)
Ig strand A' 242..247 CDD:409562 2/9 (22%)
Ig strand B 253..260 CDD:409562 1/6 (17%)
Ig strand C 266..271 CDD:409562 1/4 (25%)
Ig strand C' 273..275 CDD:409562 0/1 (0%)
Ig strand D 282..285 CDD:409562 2/3 (67%)
Ig strand E 289..295 CDD:409562 3/6 (50%)
Ig strand F 302..309 CDD:409562 3/6 (50%)
Ig strand G 315..323 CDD:409562 1/7 (14%)
IgI_NCAM-2 325..422 CDD:143278 25/107 (23%)
Ig strand A 325..330 CDD:143278 2/4 (50%)
Ig strand A' 334..338 CDD:143278 0/7 (0%)
Ig strand B 342..350 CDD:143278 1/7 (14%)
Ig strand C 356..362 CDD:143278 2/5 (40%)
Ig strand C' 365..368 CDD:143278 0/2 (0%)
Ig strand D 378..384 CDD:143278 2/8 (25%)
Ig strand E 387..393 CDD:143278 1/5 (20%)
Ig strand F 401..409 CDD:143278 4/7 (57%)
Ig strand G 412..422 CDD:143278 2/9 (22%)
Ig_3 426..504 CDD:464046 24/80 (30%)
FN3 521..613 CDD:238020 19/114 (17%)
fn3 619..703 CDD:394996 2/8 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.