DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and NCAM2

DIOPT Version :9

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:XP_011527877.1 Gene:NCAM2 / 4685 HGNCID:7657 Length:874 Species:Homo sapiens


Alignment Length:457 Identity:102/457 - (22%)
Similarity:171/457 - (37%) Gaps:90/457 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LIYMTNLVTHVMMDEPRFAQPIPNVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVI 93
            :|.:.|:...:.|.:..|     |.|...|.:....|.........::|..         :..:|
Human   226 IIVIVNVPPAISMPQKSF-----NATAERGEEMTFSCRASGSPEPAISWFR---------NGKLI 276

  Fly    94 SRIPRYSITYTDNTWLLHVNQAHQDDRGYYMCQ-VNTNPMISQVGYLQVVVPPNILDIESTPSSV 157
            ....:| |....||.|. |......|.|.|:|: .|......:..:|||.|.|:|:.:::.    
Human   277 EENEKY-ILKGSNTELT-VRNIINSDGGPYVCRATNKAGEDEKQAFLQVFVQPHIIQLKNE---- 335

  Fly   158 AVRENQNINMTCRADGFPAPKIIWRRE-------------DGEEIAVEKKKKVLVYDADVLPLTK 209
            ...||..:.:.|.|:|.|.|:|.|:|.             ||.   :|.|.:   :.:..|.:..
Human   336 TTYENGQVTLVCDAEGEPIPEITWKRAVDGFTFTEGDKSLDGR---IEVKGQ---HGSSSLHIKD 394

  Fly   210 VSRNEMGAYLCIATNGVPPSVSKRIILDVEFSPMIWVPNQLV-GAPSGTDVTIDCHTEAHPKAII 273
            |..::.|.|.|.|.:.: ....|.:.||:|::|. ::.||.: .:..|..:.|.|..:::|.|.|
Human   395 VKLSDSGRYDCEAASRI-GGHQKSMYLDIEYAPK-FISNQTIYYSWEGNPINISCDVKSNPPASI 457

  Fly   274 YWVYNSVMVLPSKKYKTDYTENSYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIPL 338
            :| ....:|||:|. .|:....|....|.|.|......|||.|.|.:.|.:|.   ..:.|.:.|
Human   458 HW-RRDKLVLPAKN-TTNLKTYSTGRKMILEIAPTSDNDFGRYNCTATNHIGT---RFQEYILAL 517

  Fly   339 PSTPSK-------QVTHTTVESRENNIIPSSRNDT-TKSLQTDVGYAMKNDLYPGSASSSSSGGS 395
            ...||.       :::.||.:...|.  |.|.... ....|.||                     
Human   518 ADVPSSPYGVKIIELSQTTAKVSFNK--PDSHGGVPIHHYQVDV--------------------- 559

  Fly   396 SSAASS------SSSMQTSALPGGVAGNS-----LSSMGSKGSLAIGKSTFYTERPPNEYAASSV 449
            ...||.      |..:||..:...:..|:     ::::..||.....|...:...|..|.:..|:
Human   560 KEVASEIWKIVRSHGVQTMVVLNNLEPNTTYEIRVAAVNGKGQGDYSKIEIFQTLPVREPSPPSI 624

  Fly   450 AG 451
            .|
Human   625 HG 626

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 20/92 (22%)
Ig 145..238 CDD:416386 24/105 (23%)
Ig strand A 145..149 CDD:409353 2/3 (67%)
Ig strand A' 154..159 CDD:409353 0/4 (0%)
Ig strand B 165..172 CDD:409353 1/6 (17%)
Ig strand C 178..183 CDD:409353 2/4 (50%)
Ig strand C' 185..187 CDD:409353 1/1 (100%)
Ig strand D 195..199 CDD:409353 0/3 (0%)
Ig strand E 203..209 CDD:409353 1/5 (20%)
Ig strand F 216..223 CDD:409353 3/6 (50%)
Ig strand G 230..238 CDD:409353 2/7 (29%)
Ig 242..333 CDD:416386 26/91 (29%)
Ig strand A' 250..253 CDD:409353 0/3 (0%)
Ig strand B 259..266 CDD:409353 2/6 (33%)
Ig strand C 272..277 CDD:409353 2/4 (50%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 1/3 (33%)
Ig strand E 295..305 CDD:409353 3/9 (33%)
Ig strand F 314..322 CDD:409353 3/7 (43%)
Ig strand G 325..334 CDD:409353 1/8 (13%)
NCAM2XP_011527877.1 Ig1_NCAM-2 46..137 CDD:143274
I-set 47..136 CDD:254352
I-set 142..218 CDD:254352
IGc2 153..214 CDD:197706
Ig 233..326 CDD:299845 22/108 (20%)
I-set 240..323 CDD:254352 19/98 (19%)
Ig5_NCAM-2 325..422 CDD:143278 25/107 (23%)
IG_like 333..420 CDD:214653 21/97 (22%)
IG_like 438..515 CDD:214653 24/81 (30%)
IGc2 439..507 CDD:197706 22/69 (32%)
FN3 521..613 CDD:238020 19/114 (17%)
fn3 619..703 CDD:278470 2/8 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.