DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and tutl

DIOPT Version :9

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001303307.1 Gene:tutl / 46015 FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster


Alignment Length:412 Identity:88/412 - (21%)
Similarity:151/412 - (36%) Gaps:71/412 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 AQPIP----NVTVAVGRDANLPCVVE----HLGGYKVAWIHIDRQMILT---------------- 87
            |..||    ::|..:|......|.||    |...|.:.|   |:::..|                
  Fly   128 AHNIPEDAVHITAILGEGVIFNCHVEFPNDHPVPYVLQW---DKKVSETGSDLPIYIWYESYPEH 189

  Fly    88 IHRHVISRIPRYSITYTDNTWLLHVNQAHQDDRGYYMCQV---NTNPMISQVG---YLQVVVPPN 146
            |......|:.|.|......:..|::....:.|:|:|.|:|   |.:|...:.|   :|.|..||.
  Fly   190 IEEGYKGRVSRVSQDSPFGSASLNLTNIRESDQGWYECKVVFLNRDPKQHKNGTWFHLDVHAPPR 254

  Fly   147 ILDIESTPSSVA-VRENQNINMTCRADGFPAPKIIWRREDGEEIAVEKKKKVLVY-DADVLPLTK 209
               ...||..:. |....:|.:.|:|||.|.|:|:|.::..   .|:....|.:: |...|.::.
  Fly   255 ---FSVTPEDIIYVNLGDSIILNCQADGTPTPEILWYKDAN---PVDPSPTVGIFNDGTELRIST 313

  Fly   210 VSRNEMGAYLCIATNGV-PPSVSKRIILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHP-KAI 272
            :...::|.|.|||.||. ..|.:.|:|  :....:|.||........|..|...|..:|.| ...
  Fly   314 IRHEDIGEYTCIARNGEGQVSHTARVI--IAGGAVIMVPPTNQTKLEGEKVIFSCEAKAMPGNVT 376

  Fly   273 IYWVYNSVMVLPSKKYKTDYTENSYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIP 337
            :.|....   .|.::.....|..:.|....|.|..::..|.|.|.|...|.:|:.:.:.....:.
  Fly   377 VRWYREG---SPVREVAALETRVTIRKDGSLIINPIKPDDSGQYLCEVTNGIGDPQSASAYLSVE 438

  Fly   338 LPS----TP-------------------SKQVTHTTVESRENNIIPSSRNDTTKSLQTDVGYAMK 379
            .|:    ||                   |.|:.:.|....:..:.|....|........:.:...
  Fly   439 YPAKVTFTPTVQYLPFRLAGVVQCYIKSSPQLQYVTWTKDKRLLEPYQMKDIVVMANGSLLFTRV 503

  Fly   380 NDLYPGSASSSSSGGSSSAASS 401
            |:.:.|..:.:......:|.:|
  Fly   504 NEEHQGQYACTPYNAQGTAGAS 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 26/121 (21%)
Ig 145..238 CDD:416386 27/95 (28%)
Ig strand A 145..149 CDD:409353 1/3 (33%)
Ig strand A' 154..159 CDD:409353 1/5 (20%)
Ig strand B 165..172 CDD:409353 2/6 (33%)
Ig strand C 178..183 CDD:409353 2/4 (50%)
Ig strand C' 185..187 CDD:409353 0/1 (0%)
Ig strand D 195..199 CDD:409353 1/3 (33%)
Ig strand E 203..209 CDD:409353 1/5 (20%)
Ig strand F 216..223 CDD:409353 4/6 (67%)
Ig strand G 230..238 CDD:409353 2/7 (29%)
Ig 242..333 CDD:416386 20/91 (22%)
Ig strand A' 250..253 CDD:409353 0/2 (0%)
Ig strand B 259..266 CDD:409353 2/6 (33%)
Ig strand C 272..277 CDD:409353 1/4 (25%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 0/3 (0%)
Ig strand E 295..305 CDD:409353 2/9 (22%)
Ig strand F 314..322 CDD:409353 3/7 (43%)
Ig strand G 325..334 CDD:409353 1/8 (13%)
tutlNP_001303307.1 V-set 137..250 CDD:284989 24/115 (21%)
IG_like 137..229 CDD:214653 19/94 (20%)
I-set 253..341 CDD:254352 27/95 (28%)
IGc2 268..331 CDD:197706 20/65 (31%)
I-set 346..437 CDD:254352 20/93 (22%)
Ig 349..437 CDD:299845 19/90 (21%)
Ig 459..530 CDD:299845 9/67 (13%)
IG_like 549..628 CDD:214653
IGc2 551..617 CDD:197706
FN3 633..725 CDD:238020
FN3 786..874 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.