DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and klg

DIOPT Version :9

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster


Alignment Length:487 Identity:122/487 - (25%)
Similarity:196/487 - (40%) Gaps:86/487 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SRFTNRRIMFLIYMTNLVTHVMMDE-PRFAQPIPNVTVAVGRDANLPCVVEHLGGYKVAWIHIDR 82
            :|.:|.|.|..:..:.:....:... |||..........||....|||.||:||.:.:.|    |
  Fly    75 NRGSNSRSMSNVQQSAVAASTLTATLPRFLSRGHTYRAVVGDTLVLPCQVENLGNFVLLW----R 135

  Fly    83 Q--MILTIHRHVISRIPRYSITYTDNTWLLHVNQAHQDDRGYYMCQVNTNPMISQVGYLQVVVPP 145
            :  .:||....:::|..|..:.   :.:.|.::.....|.|.|:||::......||..::::|||
  Fly   136 RGTNVLTASNIMVTRDERVRLI---DGYNLEISDLEPQDAGDYVCQISDKINRDQVHTVEILVPP 197

  Fly   146 NILDIESTPSSVAVRENQNINMTCRADGFPAPKIIWRREDGEEIAVEKKKKVLVYDADVLPLTKV 210
            ::..| .|...:..|:...|.:.|:..|.|.|.|.|.::.|     ..|....:.|..:|.|.|:
  Fly   198 SVRAI-PTSGQLQARKGGPITLECKGSGNPVPSIYWTKKSG-----ANKSTARIGDGPILTLEKL 256

  Fly   211 SRNEMGAYLCIATNGVPPSVSKRIILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYW 275
            .|.:.|.|.|.|.|||...|:..:.|||.:.|.|.|....:.:..|.:..:.|...|.|.|.:.|
  Fly   257 ERQQAGVYQCTADNGVGDPVTVDMRLDVLYPPDIQVEKSWIHSGEGFEAKLVCIVFADPVATVSW 321

  Fly   276 VYNSVMVLPSKKYKTDYTENSYRA--HMKLTIRNLQYGDFGNYRCISKNSLGETE---------G 329
            ..||..:     ..||....:.||  || ||||::|..|||||.|::.||||.:.         |
  Fly   322 YQNSFPI-----QSTDRRIMATRANRHM-LTIRHIQQEDFGNYSCVADNSLGRSRKYMELSGRPG 380

  Fly   330 SIRVYEIPLPSTPSK----------------QVTHTTVESRENNIIPSSRND---------TTKS 369
            :...|......:|..                ::.:..|:..|....|...:|         .::.
  Fly   381 AAEFYSPKWGRSPDSYNLTWKIDSYPPLEEVRLLYRRVQMNETYQQPGRWHDFILTPEHRPASEP 445

  Fly   370 LQTDVGYAMKNDLYPGS-------------------------ASSSSSGGSSSA--ASSSSSMQT 407
            |...:.|.:|| |:||.                         |::|...|...|  .:||.|...
  Fly   446 LTHIMSYTIKN-LHPGGYYEAIVQAKNRYGWNEVSDIFQFVVATNSQDIGPEDAEVVASSKSRSN 509

  Fly   408 SALPGGVAGNSLSSMGSKGSLAIGKSTFYTER 439
            ||..|.:.|:::.......:||:....|...|
  Fly   510 SASIGSLPGSTVLHTALLLALALSNCQFDRRR 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 23/93 (25%)
Ig 145..238 CDD:416386 27/92 (29%)
Ig strand A 145..149 CDD:409353 1/3 (33%)
Ig strand A' 154..159 CDD:409353 0/4 (0%)
Ig strand B 165..172 CDD:409353 2/6 (33%)
Ig strand C 178..183 CDD:409353 2/4 (50%)
Ig strand C' 185..187 CDD:409353 0/1 (0%)
Ig strand D 195..199 CDD:409353 0/3 (0%)
Ig strand E 203..209 CDD:409353 2/5 (40%)
Ig strand F 216..223 CDD:409353 3/6 (50%)
Ig strand G 230..238 CDD:409353 2/7 (29%)
Ig 242..333 CDD:416386 33/101 (33%)
Ig strand A' 250..253 CDD:409353 0/2 (0%)
Ig strand B 259..266 CDD:409353 1/6 (17%)
Ig strand C 272..277 CDD:409353 1/4 (25%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 2/3 (67%)
Ig strand E 295..305 CDD:409353 5/11 (45%)
Ig strand F 314..322 CDD:409353 4/7 (57%)
Ig strand G 325..334 CDD:409353 2/17 (12%)
klgNP_524454.2 DUF1370 63..>124 CDD:284518 12/48 (25%)
IG_like 109..195 CDD:214653 23/92 (25%)
Ig 118..191 CDD:143165 21/79 (27%)
IG_like 205..274 CDD:214653 22/73 (30%)
IGc2 213..273 CDD:197706 20/64 (31%)
IGc2 301..367 CDD:197706 27/71 (38%)
FN3 392..486 CDD:238020 12/94 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
32.810

Return to query results.
Submit another query.