| Sequence 1: | NP_001097508.2 | Gene: | DIP-delta / 5740816 | FlyBaseID: | FBgn0085420 | Length: | 469 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_996226.2 | Gene: | Dscam3 / 42103 | FlyBaseID: | FBgn0261046 | Length: | 2087 | Species: | Drosophila melanogaster |
| Alignment Length: | 320 | Identity: | 82/320 - (25%) |
|---|---|---|---|
| Similarity: | 122/320 - (38%) | Gaps: | 44/320 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 121 GYYMCQV-NTNPMISQVGYLQVVVPPNILDIESTPSSVAVRENQNINMTCRADGFPAPKIIWRRE 184
Fly 185 DGEEIAVEKKKKVLVYDADVLPLTKVSRNEMGAYLCIATNGVPPSVSKRIILDVEFSPMIWVPNQ 249
Fly 250 LVGAPSGTDVTIDCHTEAHPKAIIYWVYNSVMVLPSKKYKTDYTENSYR---AHMK--------L 303
Fly 304 TIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIPLPSTPSK----QVTHTTVESRENNIIPSSRN 364
Fly 365 ----------DTTKSLQTDVGYAMKNDLYPGSASSSSSGGSSSAASSSSSMQTSALPGGV 414 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| DIP-delta | NP_001097508.2 | IG | 51..143 | CDD:214652 | 7/22 (32%) |
| Ig | 145..238 | CDD:416386 | 26/92 (28%) | ||
| Ig strand A | 145..149 | CDD:409353 | 1/3 (33%) | ||
| Ig strand A' | 154..159 | CDD:409353 | 1/4 (25%) | ||
| Ig strand B | 165..172 | CDD:409353 | 2/6 (33%) | ||
| Ig strand C | 178..183 | CDD:409353 | 2/4 (50%) | ||
| Ig strand C' | 185..187 | CDD:409353 | 0/1 (0%) | ||
| Ig strand D | 195..199 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 203..209 | CDD:409353 | 2/5 (40%) | ||
| Ig strand F | 216..223 | CDD:409353 | 3/6 (50%) | ||
| Ig strand G | 230..238 | CDD:409353 | 2/7 (29%) | ||
| Ig | 242..333 | CDD:416386 | 26/101 (26%) | ||
| Ig strand A' | 250..253 | CDD:409353 | 0/2 (0%) | ||
| Ig strand B | 259..266 | CDD:409353 | 5/6 (83%) | ||
| Ig strand C | 272..277 | CDD:409353 | 2/4 (50%) | ||
| Ig strand C' | 281..283 | CDD:409353 | 0/1 (0%) | ||
| Ig strand D | 289..293 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 295..305 | CDD:409353 | 6/20 (30%) | ||
| Ig strand F | 314..322 | CDD:409353 | 5/7 (71%) | ||
| Ig strand G | 325..334 | CDD:409353 | 3/8 (38%) | ||
| Dscam3 | NP_996226.2 | IG | 56..133 | CDD:214652 | |
| Ig | 56..125 | CDD:143165 | |||
| I-set | 246..337 | CDD:254352 | |||
| Ig | 264..334 | CDD:143165 | |||
| I-set | 345..433 | CDD:254352 | |||
| Ig | 358..431 | CDD:143165 | |||
| Ig | 456..533 | CDD:143165 | |||
| IGc2 | 553..619 | CDD:197706 | |||
| I-set | 634..724 | CDD:254352 | 5/20 (25%) | ||
| ig | 645..712 | CDD:278476 | 3/8 (38%) | ||
| IG_like | 734..815 | CDD:214653 | 25/83 (30%) | ||
| Ig | 745..815 | CDD:299845 | 23/72 (32%) | ||
| I-set | 820..913 | CDD:254352 | 26/102 (25%) | ||
| Ig | 838..920 | CDD:299845 | 25/91 (27%) | ||
| FN3 | 917..1033 | CDD:238020 | 21/90 (23%) | ||
| FN3 | 1040..1142 | CDD:238020 | |||
| fn3 | 1150..1237 | CDD:278470 | |||
| FN3 | 1263..1345 | CDD:238020 | |||
| Ig | 1350..1436 | CDD:299845 | |||
| IG_like | 1358..1436 | CDD:214653 | |||
| FN3 | 1441..1530 | CDD:238020 | |||
| FN3 | 1542..1620 | CDD:238020 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||