DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and dpr15

DIOPT Version :10

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_731672.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster


Alignment Length:461 Identity:81/461 - (17%)
Similarity:137/461 - (29%) Gaps:174/461 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PSRFTNRRIMFLIYMTNLVTHVMMDEPRFAQPIPNVTVAVGRDANLPCVVEHLGGYKVAWIHIDR 82
            |:..|.|.....:..|.|.....:|:      ...:....|..|.|||.|:.|....::|:.:..
  Fly   170 PTTTTRRTTRRPVATTTLKPPPTIDD------YQTIISQAGTHAYLPCNVKQLVKKPISWLRMRD 228

  Fly    83 QMILTIHRHVISRIPRYSITYTDN--TWLLHVNQAHQDDRGYYMCQVNTNPMISQVGYLQVVVPP 145
            ..|||:.:.......|:...::.|  .|.|.:......|.|.|.|||:|.|..|.:.:|::|.|.
  Fly   229 GHILTVDQTTFIADQRFQSVFSPNPERWSLQIKYVQLKDEGTYECQVSTEPKASAIVHLRIVEPK 293

  Fly   146 NILDIESTPSSVAVRENQNINMTCRADGFPAPKIIWRREDGEEIAVEKKKKVLVYDADVLPLTKV 210
            ..|..|||....|                           |.::.:.                  
  Fly   294 TELIGESTRHVKA---------------------------GSQVKLR------------------ 313

  Fly   211 SRNEMGAYLCIATNGVPPSVSKRIILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYW 275
                     ||.:..:.|.:                                         .|.|
  Fly   314 ---------CIISQALEPPL-----------------------------------------FINW 328

  Fly   276 VYNSVMVLPSKKYKTDYTENSYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIP--L 338
            .||.         |..|..|  |...:..|..:                          ::|  :
  Fly   329 FYNQ---------KQIYLHN--RRGWRTEIERI--------------------------DLPAEV 356

  Fly   339 PSTPSKQVTHTTVESRENNIIPSSRNDTTKSLQTDVGYAMKNDLYPGSASSSSSGGSSSAASSSS 403
            |:|.:...|.||..|           .||.:..|.          |.:.|::::|.:..|.||.:
  Fly   357 PTTSTTTTTTTTTAS-----------TTTTTTSTT----------PATPSTTATGSTEGATSSET 400

  Fly   404 -----SMQTSALPGGVAGNSLSSMGSKGSLAIGKSTFYTERPPNEYAASSV------AGLLLHRA 457
                 ::..|.:...::.|.:|.:|:...:|:...|...:......|.||.      ||||...:
  Fly   401 LNGLVTITRSYILDAISQNDVSELGAAAGVAVATETSTAQLLTEVEATSSTSGTSTGAGLLASTS 465

  Fly   458 LLFGSG 463
            ..:.:|
  Fly   466 AAYAAG 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG_like 51..143 CDD:214653 25/93 (27%)
Ig strand B 61..65 CDD:409353 2/3 (67%)
Ig strand C 74..78 CDD:409353 0/3 (0%)
Ig strand E 105..112 CDD:409353 3/8 (38%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 134..137 CDD:409353 1/2 (50%)
Ig 145..238 CDD:472250 9/92 (10%)
Ig strand B 165..169 CDD:409353 0/3 (0%)
Ig strand C 178..182 CDD:409353 0/3 (0%)
Ig strand E 203..207 CDD:409353 0/3 (0%)
Ig strand F 217..222 CDD:409353 1/4 (25%)
Ig strand G 231..234 CDD:409353 0/2 (0%)
Ig 242..333 CDD:472250 9/90 (10%)
Ig strand B 259..263 CDD:409353 0/3 (0%)
Ig strand C 272..276 CDD:409353 1/3 (33%)
Ig strand E 295..305 CDD:409353 2/9 (22%)
Ig strand F 315..320 CDD:409353 0/4 (0%)
Ig strand G 328..331 CDD:409353 0/2 (0%)
dpr15NP_731672.1 V-set 204..290 CDD:462230 25/85 (29%)

Return to query results.
Submit another query.