DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and dpr5

DIOPT Version :10

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster


Alignment Length:207 Identity:65/207 - (31%)
Similarity:93/207 - (44%) Gaps:27/207 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 VTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISRIPRYSITYTDNT--WLLHVNQA 115
            |..|:|..|.|.|.|.|||...|:||......||||.....:...|:...:.||:  |:|.:...
  Fly   100 VIAALGTTARLHCRVRHLGDRAVSWIRQRDLHILTIGIMTYTNDQRFLARHIDNSDEWVLKIVSV 164

  Fly   116 HQDDRGYYMCQVNTNPMISQVGYLQVVVPPNILDIESTPSSVAVRE-----NQNINMTCRADGFP 175
            .|.|.|.|.|||:|.|.|| :.|..|||       .|....:|.||     ..:||:||.|...|
  Fly   165 QQRDAGVYECQVSTE
PKIS-LAYKLVVV-------TSKAQILANRELFIQSGSDINLTCIAPQAP 221

  Fly   176 AP--KIIWRRE-----DGEE--IAVEKKKKVLVYDADVLPLTKVSRNEMGAYLCIATNGVPPSVS 231
            .|  .::|.::     |...  |.||.::::...:   |.:::|...:.|.|.|.|.|....||.
  Fly   222 GPYTHMLWHKDTELVSDSARGGIRVESEQQMKTSN---LVISRVQHTDSGNYTCSADNSNSDSVF 283

  Fly   232 KRIILDVEFSPM 243
            ..||...:.:.|
  Fly   284 VHIIKSEQHAAM 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG_like 51..143 CDD:214653 35/91 (38%)
Ig strand B 61..65 CDD:409353 2/3 (67%)
Ig strand C 74..78 CDD:409353 1/3 (33%)
Ig strand E 105..112 CDD:409353 4/8 (50%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 134..137 CDD:409353 1/2 (50%)
Ig 145..238 CDD:472250 27/106 (25%)
Ig strand B 165..169 CDD:409353 2/3 (67%)
Ig strand C 178..182 CDD:409353 0/3 (0%)
Ig strand E 203..207 CDD:409353 1/3 (33%)
Ig strand F 217..222 CDD:409353 2/4 (50%)
Ig strand G 231..234 CDD:409353 0/2 (0%)
Ig 242..333 CDD:472250 1/2 (50%)
Ig strand B 259..263 CDD:409353
Ig strand C 272..276 CDD:409353
Ig strand E 295..305 CDD:409353
Ig strand F 315..320 CDD:409353
Ig strand G 328..331 CDD:409353
dpr5NP_650080.3 FR1 96..113 CDD:409355 5/12 (42%)
IG_like 98..179 CDD:214653 29/78 (37%)
Ig strand A' 100..102 CDD:409355 1/1 (100%)
Ig strand B 106..114 CDD:409355 3/7 (43%)
CDR1 114..120 CDD:409355 4/5 (80%)
FR2 121..132 CDD:409355 3/10 (30%)
Ig strand C 121..127 CDD:409355 3/5 (60%)
Ig strand C' 130..133 CDD:409355 0/2 (0%)
CDR2 133..146 CDD:409355 3/12 (25%)
Ig strand D 146..151 CDD:409355 0/4 (0%)
FR3 147..176 CDD:409355 9/28 (32%)
Ig strand E 155..162 CDD:409355 2/6 (33%)
Ig strand F 170..177 CDD:409355 4/6 (67%)
IG_like 206..278 CDD:214653 19/74 (26%)
Ig strand B 211..215 CDD:409353 2/3 (67%)
Ig strand C 226..230 CDD:409353 0/3 (0%)
Ig strand E 255..259 CDD:409353 1/6 (17%)
Ig strand F 269..274 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.