| Sequence 1: | NP_001097508.2 | Gene: | DIP-delta / 5740816 | FlyBaseID: | FBgn0085420 | Length: | 469 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_650080.3 | Gene: | dpr5 / 41381 | FlyBaseID: | FBgn0037908 | Length: | 336 | Species: | Drosophila melanogaster |
| Alignment Length: | 207 | Identity: | 65/207 - (31%) |
|---|---|---|---|
| Similarity: | 93/207 - (44%) | Gaps: | 27/207 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 53 VTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISRIPRYSITYTDNT--WLLHVNQA 115
Fly 116 HQDDRGYYMCQVNTNPMISQVGYLQVVVPPNILDIESTPSSVAVRE-----NQNINMTCRADGFP 175
Fly 176 AP--KIIWRRE-----DGEE--IAVEKKKKVLVYDADVLPLTKVSRNEMGAYLCIATNGVPPSVS 231
Fly 232 KRIILDVEFSPM 243 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| DIP-delta | NP_001097508.2 | IG_like | 51..143 | CDD:214653 | 35/91 (38%) |
| Ig strand B | 61..65 | CDD:409353 | 2/3 (67%) | ||
| Ig strand C | 74..78 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 105..112 | CDD:409353 | 4/8 (50%) | ||
| Ig strand F | 122..127 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 134..137 | CDD:409353 | 1/2 (50%) | ||
| Ig | 145..238 | CDD:472250 | 27/106 (25%) | ||
| Ig strand B | 165..169 | CDD:409353 | 2/3 (67%) | ||
| Ig strand C | 178..182 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 203..207 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 217..222 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 231..234 | CDD:409353 | 0/2 (0%) | ||
| Ig | 242..333 | CDD:472250 | 1/2 (50%) | ||
| Ig strand B | 259..263 | CDD:409353 | |||
| Ig strand C | 272..276 | CDD:409353 | |||
| Ig strand E | 295..305 | CDD:409353 | |||
| Ig strand F | 315..320 | CDD:409353 | |||
| Ig strand G | 328..331 | CDD:409353 | |||
| dpr5 | NP_650080.3 | FR1 | 96..113 | CDD:409355 | 5/12 (42%) |
| IG_like | 98..179 | CDD:214653 | 29/78 (37%) | ||
| Ig strand A' | 100..102 | CDD:409355 | 1/1 (100%) | ||
| Ig strand B | 106..114 | CDD:409355 | 3/7 (43%) | ||
| CDR1 | 114..120 | CDD:409355 | 4/5 (80%) | ||
| FR2 | 121..132 | CDD:409355 | 3/10 (30%) | ||
| Ig strand C | 121..127 | CDD:409355 | 3/5 (60%) | ||
| Ig strand C' | 130..133 | CDD:409355 | 0/2 (0%) | ||
| CDR2 | 133..146 | CDD:409355 | 3/12 (25%) | ||
| Ig strand D | 146..151 | CDD:409355 | 0/4 (0%) | ||
| FR3 | 147..176 | CDD:409355 | 9/28 (32%) | ||
| Ig strand E | 155..162 | CDD:409355 | 2/6 (33%) | ||
| Ig strand F | 170..177 | CDD:409355 | 4/6 (67%) | ||
| IG_like | 206..278 | CDD:214653 | 19/74 (26%) | ||
| Ig strand B | 211..215 | CDD:409353 | 2/3 (67%) | ||
| Ig strand C | 226..230 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 255..259 | CDD:409353 | 1/6 (17%) | ||
| Ig strand F | 269..274 | CDD:409353 | 2/4 (50%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||