DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and dpr11

DIOPT Version :10

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_788586.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster


Alignment Length:200 Identity:59/200 - (29%)
Similarity:87/200 - (43%) Gaps:20/200 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 NVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISRIPRY-SITYTDNTWLLHVNQA 115
            |||..:|..|.|||.|:.||...|:||.:....|||:.|.|.....|: :|...|..|.|.:...
  Fly   126 NVTTQIGTHAYLPCRVKQLGNKSVSWIRLRDGHILTVDRAVFIADQRFLAIKQPDKYWTLQIKYV 190

  Fly   116 HQDDRGYYMCQVNTNPMISQVGYLQVVVPPNILDIESTPSSVAVRENQNINMTCRADGF--PAPK 178
            ...|.|.|.|||:|.|.:|....||||||..  :|...|... |:...|:.:.|...|.  |...
  Fly   191 QARDAGSYECQVSTEPKVSARVQLQV
VVPRT--EILGEPDRY-VKAGSNVVLRCIVRGALEPPTF 252

  Fly   179 IIWRREDGEEIAVEKKKKVLVYDADV-------------LPLTKVSRNEMGAYLCIATNGVPPSV 230
            |:| ....|::|.:.::.....|.::             |.:....:.:.|.|.|..:|....:|
  Fly   253 IMW-YHGAEQLAADSRRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRDTGNYTCSPSNSPSATV 316

  Fly   231 SKRII 235
            :..||
  Fly   317 TLNII 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG_like 51..143 CDD:214653 36/91 (40%)
Ig strand B 61..65 CDD:409353 2/3 (67%)
Ig strand C 74..78 CDD:409353 1/3 (33%)
Ig strand E 105..112 CDD:409353 3/6 (50%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 134..137 CDD:409353 1/2 (50%)
Ig 145..238 CDD:472250 19/105 (18%)
Ig strand B 165..169 CDD:409353 0/3 (0%)
Ig strand C 178..182 CDD:409353 1/3 (33%)
Ig strand E 203..207 CDD:409353 1/16 (6%)
Ig strand F 217..222 CDD:409353 2/4 (50%)
Ig strand G 231..234 CDD:409353 0/2 (0%)
Ig 242..333 CDD:472250
Ig strand B 259..263 CDD:409353
Ig strand C 272..276 CDD:409353
Ig strand E 295..305 CDD:409353
Ig strand F 315..320 CDD:409353
Ig strand G 328..331 CDD:409353
dpr11NP_788586.1 Ig 125..216 CDD:472250 34/89 (38%)
Ig strand B 135..139 CDD:409353 2/3 (67%)
Ig strand C 148..152 CDD:409353 1/3 (33%)
Ig strand E 183..187 CDD:409353 2/3 (67%)
Ig strand F 197..202 CDD:409353 2/4 (50%)
IG_like 227..320 CDD:214653 17/94 (18%)
Ig strand B 237..241 CDD:409544 0/3 (0%)
Ig strand C 252..256 CDD:409544 2/4 (50%)
Ig strand E 289..293 CDD:409544 1/3 (33%)
Ig strand G 313..316 CDD:409544 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.