Sequence 1: | NP_001097508.2 | Gene: | DIP-delta / 5740816 | FlyBaseID: | FBgn0085420 | Length: | 469 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001094842.1 | Gene: | IGLON5 / 402665 | HGNCID: | 34550 | Length: | 336 | Species: | Homo sapiens |
Alignment Length: | 310 | Identity: | 89/310 - (28%) |
---|---|---|---|
Similarity: | 132/310 - (42%) | Gaps: | 60/310 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 46 FAQPIPNVTVAVGRDANLPCVV-EHLGGYKVAWIHIDRQMILTIHRHVISRIPRYSITY-TDNTW 108
Fly 109 LLHVNQAHQDDRGYYMCQVNT--NPMISQVGYLQVVVPPNILDIESTPSSVAVRENQNINMTCRA 171
Fly 172 DGFPAPKIIWRR-EDGEEIAVEKKKKVLVYDADVLPLTKVSRNEMGAYLCIATNGVPPSV-SKRI 234
Fly 235 ILDVEFSPMIWVPNQLVGAPSGTDVT-----------IDCHTEAHPKAIIYWVYNSVMVLPS--- 285
Fly 286 --KKYKTDYTENSYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRV 333 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DIP-delta | NP_001097508.2 | IG | 51..143 | CDD:214652 | 29/95 (31%) |
Ig | 145..238 | CDD:416386 | 27/94 (29%) | ||
Ig strand A | 145..149 | CDD:409353 | 1/3 (33%) | ||
Ig strand A' | 154..159 | CDD:409353 | 2/4 (50%) | ||
Ig strand B | 165..172 | CDD:409353 | 2/6 (33%) | ||
Ig strand C | 178..183 | CDD:409353 | 1/4 (25%) | ||
Ig strand C' | 185..187 | CDD:409353 | 1/1 (100%) | ||
Ig strand D | 195..199 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 203..209 | CDD:409353 | 1/5 (20%) | ||
Ig strand F | 216..223 | CDD:409353 | 3/6 (50%) | ||
Ig strand G | 230..238 | CDD:409353 | 2/8 (25%) | ||
Ig | 242..333 | CDD:416386 | 27/106 (25%) | ||
Ig strand A' | 250..253 | CDD:409353 | 0/2 (0%) | ||
Ig strand B | 259..266 | CDD:409353 | 3/17 (18%) | ||
Ig strand C | 272..277 | CDD:409353 | 1/4 (25%) | ||
Ig strand C' | 281..283 | CDD:409353 | 0/1 (0%) | ||
Ig strand D | 289..293 | CDD:409353 | 1/3 (33%) | ||
Ig strand E | 295..305 | CDD:409353 | 2/9 (22%) | ||
Ig strand F | 314..322 | CDD:409353 | 4/7 (57%) | ||
Ig strand G | 325..334 | CDD:409353 | 3/9 (33%) | ||
IGLON5 | NP_001094842.1 | Ig | 41..129 | CDD:416386 | 28/92 (30%) |
Ig strand A' | 41..46 | CDD:409353 | 3/4 (75%) | ||
Ig strand B | 48..56 | CDD:409353 | 3/7 (43%) | ||
CDR1 | 56..60 | CDD:409353 | 1/3 (33%) | ||
FR2 | 61..68 | CDD:409353 | 3/8 (38%) | ||
Ig strand C | 61..67 | CDD:409353 | 3/7 (43%) | ||
CDR2 | 69..79 | CDD:409353 | 2/9 (22%) | ||
Ig strand C' | 71..74 | CDD:409353 | 2/2 (100%) | ||
Ig strand C' | 76..79 | CDD:409353 | 0/2 (0%) | ||
FR3 | 80..115 | CDD:409353 | 7/34 (21%) | ||
Ig strand D | 84..91 | CDD:409353 | 1/6 (17%) | ||
Ig strand E | 94..100 | CDD:409353 | 0/5 (0%) | ||
Ig strand F | 107..115 | CDD:409353 | 3/7 (43%) | ||
CDR3 | 116..120 | CDD:409353 | 1/3 (33%) | ||
Ig strand G | 120..129 | CDD:409353 | 5/9 (56%) | ||
FR4 | 122..129 | CDD:409353 | 4/7 (57%) | ||
Ig_3 | 134..199 | CDD:404760 | 22/78 (28%) | ||
Ig strand B | 148..157 | CDD:409353 | 3/8 (38%) | ||
Ig strand C | 162..170 | CDD:409353 | 3/7 (43%) | ||
Ig strand F | 191..199 | CDD:409353 | 3/7 (43%) | ||
Ig strand G | 202..212 | CDD:409353 | 2/9 (22%) | ||
Ig_3 | 217..295 | CDD:404760 | 23/96 (24%) | ||
putative Ig strand A | 218..224 | CDD:409353 | 4/17 (24%) | ||
Ig strand B | 234..238 | CDD:409353 | 0/3 (0%) | ||
Ig strand C | 247..251 | CDD:409353 | 1/4 (25%) | ||
Ig strand E | 274..278 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 288..293 | CDD:409353 | 3/4 (75%) | ||
Ig strand G | 301..304 | CDD:409353 | 0/2 (0%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 45 | 1.000 | Domainoid score | I12195 |
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 141 | 1.000 | Inparanoid score | I4481 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D265311at33208 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000150 | |
OrthoInspector | 1 | 1.000 | - | - | mtm8497 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X97 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
9 | 8.870 |