DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and dpr10

DIOPT Version :10

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster


Alignment Length:401 Identity:101/401 - (25%)
Similarity:144/401 - (35%) Gaps:123/401 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 DEPRFAQPIP-NVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISRIPRYSITY-- 103
            :||.|...:| |:|..||:.|.|.|.|:|||...||||......|||:..:..:...|:..:|  
  Fly    51 NEPYFDLTMPRNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHR 115

  Fly   104 TDNTWLLHVNQAHQDDRGYYMCQVNTNPMISQVGYLQVVVPPNILDIEST--------------- 153
            ..:.|.|.:..|.|.|.|.|.||::|.|:.|....|.:|   :::|.|::               
  Fly   116 DIDEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIV---DLIDAETSDIMQQYYNDDAFYIA 177

  Fly   154 ------------------------PSS-------VAVRENQNINMTCRADGFPAP--KIIWRRED 185
                                    |::       :.|.:...||:||.....|.|  .|.|..:|
  Fly   178 ENRVYQSSNDEFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQD 242

  Fly   186 ---GEEI-----------AVEKKKKVLVYDADVLPLTKVSRNEMGAYLCIATNGVPPSVSKRIIL 236
               .||.           :.|.|..:|:||||:|        ..|.|.|..:|....|:...::.
  Fly   243 KVLSEETSGGRLKFKTIKSEETKSILLIYDADLL--------HSGKYSCYPSNTEIASIRVHVLQ 299

  Fly   237 DVEFSPMIWVPNQLVGAPSGTDVTI-DCHTEAHPKAI-IYWVYNSVMVLPSKKYKTDYTENSYRA 299
            ......|     |...||:...:.. .||.....:|: :.....:.:||             ..|
  Fly   300 GERPEAM-----QTNAAPAAVALACWSCHFGQATQAVRVISTMVAALVL-------------LEA 346

  Fly   300 HMKLTIRNLQYGDFGNYRCISKNSLGETEGSI--RVYEI---PL------PSTPSKQVTHTTVES 353
            ...|.   ||.|..|.  |...   |...|.:  ||.||   ||      |..||     ||...
  Fly   347 CSSLL---LQSGGGGG--CPGG---GSPAGGMPTRVREIREKPLTNSLLDPKIPS-----TTSAE 398

  Fly   354 RENNIIPSSRN 364
            |.||   .|||
  Fly   399 RVNN---GSRN 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG_like 51..143 CDD:214653 34/94 (36%)
Ig strand B 61..65 CDD:409353 2/3 (67%)
Ig strand C 74..78 CDD:409353 2/3 (67%)
Ig strand E 105..112 CDD:409353 2/6 (33%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 134..137 CDD:409353 1/2 (50%)
Ig 145..238 CDD:472250 28/154 (18%)
Ig strand B 165..169 CDD:409353 2/3 (67%)
Ig strand C 178..182 CDD:409353 1/3 (33%)
Ig strand E 203..207 CDD:409353 2/3 (67%)
Ig strand F 217..222 CDD:409353 2/4 (50%)
Ig strand G 231..234 CDD:409353 0/2 (0%)
Ig 242..333 CDD:472250 18/94 (19%)
Ig strand B 259..263 CDD:409353 0/4 (0%)
Ig strand C 272..276 CDD:409353 0/4 (0%)
Ig strand E 295..305 CDD:409353 2/9 (22%)
Ig strand F 315..320 CDD:409353 1/4 (25%)
Ig strand G 328..331 CDD:409353 1/2 (50%)
dpr10NP_729591.1 Ig 53..138 CDD:472250 30/84 (36%)
Ig strand B 71..75 CDD:409371 2/3 (67%)
Ig strand E 120..124 CDD:409371 2/3 (67%)
Ig_3 214..287 CDD:464046 23/80 (29%)

Return to query results.
Submit another query.