DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and dpr13

DIOPT Version :9

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster


Alignment Length:200 Identity:54/200 - (27%)
Similarity:82/200 - (41%) Gaps:39/200 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 VTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISRIPRYSITYTDNT--WLLHVNQA 115
            ||..:|..|::||.|.|:|...|:||......:||:.....|...|:|.|:..::  |.|.:...
  Fly   185 VTTQIGATAHVPCTVHHIGEGVVSWIRKKDYHLLTVGLTTYSSDERFSATHLKHSEDWTLQIKFV 249

  Fly   116 HQDDRGYYMCQVNTNPMISQVGYLQVV------VPPNILDIESTPSSVAVRENQNINMTCRADGF 174
            ...|.|.|.|||:|:|..|...:|.||      ..|.|..:  ||.|       .:.:.||    
  Fly   250 QLRDAGVYECQVSTHPPTSIFLHLSVV
EARAEITGPPIRYL--TPGS-------TLRLQCR---- 301

  Fly   175 PAPKIIWRREDGEEIAVEKKKKVLVYDAD--------------VLPLTKVSRNEMGAYLCIATNG 225
                ::...|..|.|......:::.||.|              .|.:.:..|...|.:.|:|:|.
  Fly   302 ----VVQNTEASEYIFWYHDNRMINYDIDRGINVSTEPDFQSSELTIQRTRREHSGNFTCVASNT 362

  Fly   226 VPPSV 230
            .|.||
  Fly   363 QPASV 367

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 32/97 (33%)
Ig 145..238 CDD:416386 21/99 (21%)
Ig strand A 145..149 CDD:409353 2/3 (67%)
Ig strand A' 154..159 CDD:409353 2/4 (50%)
Ig strand B 165..172 CDD:409353 2/6 (33%)
Ig strand C 178..183 CDD:409353 0/4 (0%)
Ig strand C' 185..187 CDD:409353 0/1 (0%)
Ig strand D 195..199 CDD:409353 0/3 (0%)
Ig strand E 203..209 CDD:409353 2/19 (11%)
Ig strand F 216..223 CDD:409353 2/6 (33%)