DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and dpr13

DIOPT Version :10

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster


Alignment Length:200 Identity:54/200 - (27%)
Similarity:82/200 - (41%) Gaps:39/200 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 VTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISRIPRYSITYTDNT--WLLHVNQA 115
            ||..:|..|::||.|.|:|...|:||......:||:.....|...|:|.|:..::  |.|.:...
  Fly   185 VTTQIGATAHVPCTVHHIGEGVVSWIRKKDYHLLTVGLTTYSSDERFSATHLKHSEDWTLQIKFV 249

  Fly   116 HQDDRGYYMCQVNTNPMISQVGYLQVV------VPPNILDIESTPSSVAVRENQNINMTCRADGF 174
            ...|.|.|.|||:|:|..|...:|.||      ..|.|..:  ||.|       .:.:.||    
  Fly   250 QLRDAGVYECQVSTHPPTSIFLHLSVV
EARAEITGPPIRYL--TPGS-------TLRLQCR---- 301

  Fly   175 PAPKIIWRREDGEEIAVEKKKKVLVYDAD--------------VLPLTKVSRNEMGAYLCIATNG 225
                ::...|..|.|......:::.||.|              .|.:.:..|...|.:.|:|:|.
  Fly   302 ----VVQNTEASEYIFWYHDNRMINYDIDRGINVSTEPDFQSSELTIQRTRREHSGNFTCVASNT 362

  Fly   226 VPPSV 230
            .|.||
  Fly   363 QPASV 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG_like 51..143 CDD:214653 32/97 (33%)
Ig strand B 61..65 CDD:409353 1/3 (33%)
Ig strand C 74..78 CDD:409353 1/3 (33%)
Ig strand E 105..112 CDD:409353 2/8 (25%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 134..137 CDD:409353 1/2 (50%)
Ig 145..238 CDD:472250 21/99 (21%)
Ig strand B 165..169 CDD:409353 0/3 (0%)
Ig strand C 178..182 CDD:409353 0/3 (0%)
Ig strand E 203..207 CDD:409353 2/17 (12%)
Ig strand F 217..222 CDD:409353 1/4 (25%)
Ig strand G 231..234 CDD:409353 53/199 (27%)
Ig 242..333 CDD:472250
Ig strand B 259..263 CDD:409353
Ig strand C 272..276 CDD:409353
Ig strand E 295..305 CDD:409353
Ig strand F 315..320 CDD:409353
Ig strand G 328..331 CDD:409353
dpr13NP_001033956.2 V-set 180..276 CDD:462230 30/90 (33%)
Ig_3 281..361 CDD:464046 18/96 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.