DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and TMIGD1

DIOPT Version :9

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_996663.1 Gene:TMIGD1 / 388364 HGNCID:32431 Length:262 Species:Homo sapiens


Alignment Length:182 Identity:47/182 - (25%)
Similarity:95/182 - (52%) Gaps:22/182 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 IESTPSSVAVRENQNINMTCRADGFP-APKIIWRREDGEEIAVEKKKKVLVYDADVLPLTKVSRN 213
            :::||.|.|       ::.|...... ..:::|.||:| .:.::...|:   ::..:.::.:|.|
Human    42 LDTTPGSQA-------SLICAVQNHTREEELLWYREEG-RVDLKSGNKI---NSSSVCVSSISEN 95

  Fly   214 EMG-AYLCIATNGVPPSVSKRIILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYWVY 277
            :.| ::.|  ..|...|||..::|:|.|.|:: ..|.......|::|.:.|:.:|:|:|.:.|..
Human    96 DNGISFTC--RLGRDQSVSVSVVLNVTFPPLL-SGNDFQTVEEGSNVKLVCNVKANPQAQMMWYK 157

  Fly   278 NSVMV-LPSKKYKTDYTENSYRAHMKLTIRNLQYGDFGNYRCISKNSLGETE 328
            ||.:: |...:::...|..|:    :|:|..::..|.|.|.||:|:|| :||
Human   158 NSSLLDLEKSRHQIQQTSESF----QLSITKVEKPDNGTYSCIAKSSL-KTE 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652
Ig 145..238 CDD:416386 19/89 (21%)
Ig strand A 145..149 CDD:409353
Ig strand A' 154..159 CDD:409353 2/4 (50%)
Ig strand B 165..172 CDD:409353 1/6 (17%)
Ig strand C 178..183 CDD:409353 1/4 (25%)
Ig strand C' 185..187 CDD:409353 0/1 (0%)
Ig strand D 195..199 CDD:409353 1/3 (33%)
Ig strand E 203..209 CDD:409353 0/5 (0%)
Ig strand F 216..223 CDD:409353 2/7 (29%)
Ig strand G 230..238 CDD:409353 3/7 (43%)
Ig 242..333 CDD:416386 26/88 (30%)
Ig strand A' 250..253 CDD:409353 0/2 (0%)
Ig strand B 259..266 CDD:409353 2/6 (33%)
Ig strand C 272..277 CDD:409353 1/4 (25%)
Ig strand C' 281..283 CDD:409353 0/2 (0%)
Ig strand D 289..293 CDD:409353 0/3 (0%)
Ig strand E 295..305 CDD:409353 2/9 (22%)
Ig strand F 314..322 CDD:409353 4/7 (57%)
Ig strand G 325..334 CDD:409353 2/4 (50%)
TMIGD1NP_996663.1 IG 131..212 CDD:214652 24/79 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11661
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.