| Sequence 1: | NP_001097508.2 | Gene: | DIP-delta / 5740816 | FlyBaseID: | FBgn0085420 | Length: | 469 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001261500.1 | Gene: | Dscam2 / 38788 | FlyBaseID: | FBgn0265296 | Length: | 2101 | Species: | Drosophila melanogaster |
| Alignment Length: | 566 | Identity: | 134/566 - (23%) |
|---|---|---|---|
| Similarity: | 194/566 - (34%) | Gaps: | 180/566 - (31%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 22 TNRRIMFLIYMT---------NLVTHVMMD---------EPR----------------FAQPIPN 52
Fly 53 VTVAVGRDANLPCVVEHLGGYKVAWIHID----------RQMI-----LTI-------------- 88
Fly 89 -----HRHVISR-------IP-----------------RYSITYT-------------------D 105
Fly 106 NTWLLHVNQAHQ------------DDRGYYMCQV-NTNPMISQVGYLQVVVPPNILDIESTPSSV 157
Fly 158 AVRENQNINMTCRADGFPAPKIIWRREDG------EEIAVEKKKKVLVYDADVLPLTKVSRNEMG 216
Fly 217 AYLCIATNGVPPSVSKRIILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYWVYNSVM 281
Fly 282 VL-PSKKY----KTDYTENSYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEG--SIRVYEIPLP 339
Fly 340 STPS-----------------------KQVTHTTVESRE--NNIIPSSRNDTTKSLQT-DVGY-- 376
Fly 377 AMKNDLYPGS--ASSSSSGGSSSAASSSSSMQTSALPGGVAGNSLS 420 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| DIP-delta | NP_001097508.2 | IG | 51..143 | CDD:214652 | 36/181 (20%) |
| Ig | 145..238 | CDD:416386 | 31/98 (32%) | ||
| Ig strand A | 145..149 | CDD:409353 | 1/3 (33%) | ||
| Ig strand A' | 154..159 | CDD:409353 | 1/4 (25%) | ||
| Ig strand B | 165..172 | CDD:409353 | 2/6 (33%) | ||
| Ig strand C | 178..183 | CDD:409353 | 2/4 (50%) | ||
| Ig strand C' | 185..187 | CDD:409353 | 1/7 (14%) | ||
| Ig strand D | 195..199 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 203..209 | CDD:409353 | 2/5 (40%) | ||
| Ig strand F | 216..223 | CDD:409353 | 4/6 (67%) | ||
| Ig strand G | 230..238 | CDD:409353 | 3/7 (43%) | ||
| Ig | 242..333 | CDD:416386 | 22/97 (23%) | ||
| Ig strand A' | 250..253 | CDD:409353 | 1/2 (50%) | ||
| Ig strand B | 259..266 | CDD:409353 | 1/6 (17%) | ||
| Ig strand C | 272..277 | CDD:409353 | 2/4 (50%) | ||
| Ig strand C' | 281..283 | CDD:409353 | 0/1 (0%) | ||
| Ig strand D | 289..293 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 295..305 | CDD:409353 | 2/9 (22%) | ||
| Ig strand F | 314..322 | CDD:409353 | 3/7 (43%) | ||
| Ig strand G | 325..334 | CDD:409353 | 1/10 (10%) | ||
| Dscam2 | NP_001261500.1 | Ig | 51..127 | CDD:299845 | |
| Ig | 138..>203 | CDD:299845 | |||
| I-set | 238..327 | CDD:254352 | |||
| Ig | 247..327 | CDD:299845 | |||
| I-set | 332..418 | CDD:254352 | |||
| IGc2 | 344..407 | CDD:197706 | |||
| IG_like | 432..517 | CDD:214653 | 11/52 (21%) | ||
| IGc2 | 436..507 | CDD:197706 | 11/42 (26%) | ||
| I-set | 521..610 | CDD:254352 | 20/91 (22%) | ||
| IGc2 | 533..597 | CDD:197706 | 14/66 (21%) | ||
| Ig | 630..699 | CDD:143165 | 13/68 (19%) | ||
| IG_like | 714..802 | CDD:214653 | 29/89 (33%) | ||
| Ig | 725..802 | CDD:299845 | 26/78 (33%) | ||
| Ig | 823..894 | CDD:143165 | 19/72 (26%) | ||
| FN3 | 906..1006 | CDD:238020 | 22/101 (22%) | ||
| FN3 | 1013..1111 | CDD:238020 | 3/5 (60%) | ||
| FN3 | 1119..1209 | CDD:238020 | |||
| FN3 | 1219..1313 | CDD:238020 | |||
| Ig | 1336..1402 | CDD:143165 | |||
| FN3 | 1409..1498 | CDD:238020 | |||
| FN3 | 1515..1588 | CDD:238020 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||