DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and robo1

DIOPT Version :9

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_476899.1 Gene:robo1 / 37603 FlyBaseID:FBgn0005631 Length:1395 Species:Drosophila melanogaster


Alignment Length:498 Identity:110/498 - (22%)
Similarity:171/498 - (34%) Gaps:147/498 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IALNIFPSRFTNRRIMFLIYMTNLVTHVMMDEPRFAQPIPNVTVAVGRDANLPCVVEHLGG---Y 73
            ||.|:..:|.::        ...|:..|   :|.|.:...:..:..|:.|...|.|   ||   .
  Fly   234 IAQNLVGTRESS--------YAKLIVQV---KPYFMKEPKDQVMLYGQTATFHCSV---GGDPPP 284

  Fly    74 KVAW------IHIDRQMILTIHRHVISRIPRYSITYTDNTWLLHVNQAHQDDRGYYMCQVNTN-P 131
            ||.|      |.:.|..||    |....:...:||.|              |.|.|:|:.:.| .
  Fly   285 KVLWKKEEGNIPVSRARIL----HDEKSLEISNITPT--------------DEGTYVCEAHNNVG 331

  Fly   132 MISQVGYLQVVVPPNILDIESTPSSVAVRENQNINMTCRADGFPAPKIIWRREDGEEIAVEKK-- 194
            .||....|.|..|||   ....||:..|..|..:.:.|.|.|.|.|.:.|.:|....:.....  
  Fly   332 QISARASLIVHAPPN---FTKRPSNKKVGLNGVVQLPCMASGNPPPSVFWTKEGVSTLMFPNSSH 393

  Fly   195 -KKVLVYDADVLPLTKVSRNEMGAYLCIATNGVPPSVSKRII----LDVEFSPMIWV--PNQLVG 252
             ::.:..|. .|.:|.|.:.:.|.|:|.|.:.|..|..:..:    ||....|:|.:  .||.: 
  Fly   394 GRQHVAADG-TLQITDVRQEDEGYYVCSAFSVVDSSTVRVFLQVSSLDERPPPIIQIGPANQTL- 456

  Fly   253 APSGTDVTIDCHTEAHPKAIIYWVYNSVMVLPSKKYKTDYTENSYRAHMKLTIRNLQYGDFGNYR 317
             |.|:..|:.|....:|...|.|.::...|....:|       |......|.:.:||..|.|.|.
  Fly   457 -PKGSVATLPCRATGNPSPRIKWFHDGHAVQAGNRY-------SIIQGSSLRVDDLQLSDSGTYT 513

  Fly   318 CISKNSLGETE----------GSIRVYEIPLPST------------------------------- 341
            |.:....|||.          ||..::....|||                               
  Fly   514 CTASGERGETSWAATLTVEKPGSTSLHRAADPSTYPAPPGTPKVLNVSRTSISLRWAKSQEKPGA 578

  Fly   342 -------------PSKQV-----------THTTV---------------ESRENNIIPSSRNDTT 367
                         |..|.           |..|:               |:.:...:||..::|.
  Fly   579 VGPIIGYTVEYFSPDLQTGWIVAAQRVGDTQVTISGLTPGTSYVFLVRAENTQGISVPSGLSNTI 643

  Fly   368 KSLQTDVGYAMKNDLYPGSASSSSSGGSSSAASSSSSMQTSAL 410
            |:::.|...|..|||   ||:.:...|.|.....:|::..||:
  Fly   644 KTIEADFDAASANDL---SAARTLLTGKSVELIDASAINASAV 683

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 26/101 (26%)
Ig 145..238 CDD:416386 24/99 (24%)
Ig strand A 145..149 CDD:409353 2/3 (67%)
Ig strand A' 154..159 CDD:409353 2/4 (50%)
Ig strand B 165..172 CDD:409353 1/6 (17%)
Ig strand C 178..183 CDD:409353 1/4 (25%)
Ig strand C' 185..187 CDD:409353 0/1 (0%)
Ig strand D 195..199 CDD:409353 0/3 (0%)
Ig strand E 203..209 CDD:409353 1/5 (20%)
Ig strand F 216..223 CDD:409353 3/6 (50%)
Ig strand G 230..238 CDD:409353 1/11 (9%)
Ig 242..333 CDD:416386 26/102 (25%)
Ig strand A' 250..253 CDD:409353 0/2 (0%)
Ig strand B 259..266 CDD:409353 2/6 (33%)
Ig strand C 272..277 CDD:409353 2/4 (50%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 0/3 (0%)
Ig strand E 295..305 CDD:409353 2/9 (22%)
Ig strand F 314..322 CDD:409353 3/7 (43%)
Ig strand G 325..334 CDD:409353 5/18 (28%)
robo1NP_476899.1 Ig 56..151 CDD:299845
I-set 56..150 CDD:254352
I-set 157..251 CDD:254352 5/24 (21%)
Ig2_Robo 159..251 CDD:143201 5/24 (21%)
I-set 255..341 CDD:254352 27/106 (25%)
Ig3_Robo 272..341 CDD:143202 24/89 (27%)
IG_like 351..436 CDD:214653 21/85 (25%)
Ig 362..444 CDD:299845 19/82 (23%)
I-set 445..531 CDD:254352 24/94 (26%)
IGc2 459..521 CDD:197706 16/68 (24%)
FN3 549..637 CDD:238020 5/87 (6%)
FN3 673..762 CDD:238020 3/11 (27%)
fn3 770..855 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.