DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment DIP-delta and babos

DIOPT Version :9

Sequence 1:	NP_001097508.2	Gene:	DIP-delta / 5740816	FlyBaseID:	FBgn0085420	Length:	469	Species:	Drosophila melanogaster
Sequence 2:	NP_001286719.1	Gene:	babos / 37557	FlyBaseID:	FBgn0034724	Length:	196	Species:	Drosophila melanogaster

Alignment Length:	133	Identity:	30/133 - (22%)
Similarity:	52/133 - (39%)	Gaps:	28/133 - (21%)

- Green bases have known domain annotations that are detailed below.

  Fly    44 PRFAQPIP------NVTVAV----GRDANLPCVVE---HLGGYKVAWIHIDRQMILTIHRHVISR 95
            |:...|.|      |.|::|    |.|..|.|.|.   |.....|.|...|.  :::..::::.
  Fly    52 PQTKSPNPVASEKINKTLSVTGIRGEDVVLKCDVGSNLHSSDVVVLWYFGDN--VISNGKNLVQ- 113

  Fly    96 IPRYSITYTDNTWLLHVNQAHQDDRGYYMCQ-------VNTNPMISQVGYLQVVVPPNILDIEST 153
             |.:.:   |..:.|.:.:|.....|.|:|:       |||...|::.. |..:.|.:......:
  Fly   114 -PNFKL---DANYDLTILKASPQVAGSYLCKVLPSGSVVNTKVTIAEHS-LDAIAPESSTSAAGS 173

  Fly   154 PSS 156
            .||
  Fly   174 ASS 176

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
DIP-delta	NP_001097508.2	IG	51..143	CDD:214652	25/111 (23%)
		Ig	145..238	CDD:416386	2/12 (17%)
		Ig strand A	145..149	CDD:409353	0/3 (0%)
		Ig strand A'	154..159	CDD:409353	2/3 (67%)
		Ig strand B	165..172	CDD:409353
		Ig strand C	178..183	CDD:409353
		Ig strand C'	185..187	CDD:409353
		Ig strand D	195..199	CDD:409353
		Ig strand E	203..209	CDD:409353
		Ig strand F	216..223	CDD:409353
		Ig strand G	230..238	CDD:409353
		Ig	242..333	CDD:416386
		Ig strand A'	250..253	CDD:409353
		Ig strand B	259..266	CDD:409353
		Ig strand C	272..277	CDD:409353
		Ig strand C'	281..283	CDD:409353
		Ig strand D	289..293	CDD:409353
		Ig strand E	295..305	CDD:409353
		Ig strand F	314..322	CDD:409353
		Ig strand G	325..334	CDD:409353
babos	NP_001286719.1	ig	70..154	CDD:278476	20/90 (22%)
babos	NP_001286719.1	IG_like	70..154	CDD:214653	20/90 (22%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3510
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.900