DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and wrapper

DIOPT Version :10

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster


Alignment Length:468 Identity:115/468 - (24%)
Similarity:184/468 - (39%) Gaps:86/468 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 IPNVTVAVGRD-ANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISRIPRYSITYTDNTWLLHVN 113
            ||........| ..|||.:.....| |.| |.| .:.|...||.....|...:.:.:.:  |.|.
  Fly    40 IPTTVKTYENDTVQLPCTLNTPFRY-VRW-HRD-DVALVDSRHPELPPPDRIMLWPNGS--LQVA 99

  Fly   114 QAHQDDRGYYMCQVNTNP-MISQVGYLQVVVPPNILDIESTPSSVAVRENQNI----NMTCRADG 173
            .....|.|.|.|::|::. .:.|...::|.:.|.:| ||  ||.:.   .|.|    .:.|.|.|
  Fly   100 NVQSSDTGDYYCEMNSDSGHVVQQHAIEVQLAPQVL-IE--PSDLT---EQRIGAIFEVVCEAQG 158

  Fly   174 FPAPKIIWRREDGEEIAVEK---KKKVLVYDADVLPLTKVSRNEMGAYLCIATNGVPPSVSKRII 235
            .|.|.|.||. :|..|..:.   .::.|:.:..       |||:.|...|:|:|||.......:.
  Fly   159 VPQPVITWRL-NGNVIQPQSNTGNRQSLILEIK-------SRNQAGLIECVASNGVGEPAVANVY 215

  Fly   236 LDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYWVYNSVMVLPSKKYKT---------- 290
            |.|.|||.:.:|..:|....|:...::|..||.|.|.:.|.::.:.|.......|          
  Fly   216 LHVLFSPEVSIPQPVVYTKLGSRAHLECIVEAAPAATVKWFHHGLPVALGAHSTTHESELQTNRS 280

  Fly   291 -DYTENSYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIPLPS----TPSKQ--VTH 348
             |:..|:.| || |.:::::..|.|.|.|.:.|.:....||:.:...|:|.    .|..|  .:|
  Fly   281 VDHYVNAVR-HM-LVVKSVRNADMGQYECRASNQISVKSGSVELTGRPMPCLFKINPGTQSSTSH 343

  Fly   349 TTVESRENNI-----------IPSSRNDTTKSLQTD-----------------VGYAMKNDLYPG 385
            ..|...|:.:           |||  |:.|:.::|:                 ..|.: :.|.|.
  Fly   344 VLVWQTESLLPIMEFKLKFRQIPS--NNVTRQVRTNWTELTIPAQATNGLIYITTYTL-HGLQPA 405

  Fly   386 SASSSSSGGSSSAASSSSSMQTSALPGGVAGNSLSSMGSKGSLAIGKSTFYTERPPNEYAASSVA 450
            |....|....:|...|.:|.......||..  .|.:..::..|   :..|..|...||....|. 
  Fly   406 SLYEVSVLARNSFGWSDNSKIVRFATGGEV--ELPNYSTESEL---QDDFTEEDFHNEITQRSE- 464

  Fly   451 GLLLHRALLFGSG 463
              :|..:::|.||
  Fly   465 --VLSASMMFNSG 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG_like 51..143 CDD:214653 23/93 (25%)
Ig strand B 61..65 CDD:409353 1/3 (33%)
Ig strand C 74..78 CDD:409353 1/3 (33%)
Ig strand E 105..112 CDD:409353 1/6 (17%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 134..137 CDD:409353 1/2 (50%)
Ig 145..238 CDD:472250 29/99 (29%)
Ig strand B 165..169 CDD:409353 1/7 (14%)
Ig strand C 178..182 CDD:409353 1/3 (33%)
Ig strand E 203..207 CDD:409353 0/3 (0%)
Ig strand F 217..222 CDD:409353 1/4 (25%)
Ig strand G 231..234 CDD:409353 0/2 (0%)
Ig 242..333 CDD:472250 25/101 (25%)
Ig strand B 259..263 CDD:409353 0/3 (0%)
Ig strand C 272..276 CDD:409353 0/3 (0%)
Ig strand E 295..305 CDD:409353 5/9 (56%)
Ig strand F 315..320 CDD:409353 2/4 (50%)
Ig strand G 328..331 CDD:409353 1/2 (50%)
wrapperNP_477404.1 IG_like 41..118 CDD:214653 21/81 (26%)
Ig strand B 52..56 CDD:409353 1/3 (33%)
Ig strand C 64..68 CDD:409353 3/5 (60%)
Ig strand E 94..98 CDD:409353 1/5 (20%)
Ig strand F 108..113 CDD:409353 2/4 (50%)
Ig strand G 122..125 CDD:409353 1/2 (50%)
Ig 133..219 CDD:472250 28/99 (28%)
Ig strand B 150..154 CDD:409353 0/3 (0%)
Ig strand C 163..167 CDD:409353 1/3 (33%)
Ig strand E 183..187 CDD:409353 1/3 (33%)
Ig strand F 197..202 CDD:409353 1/4 (25%)
Ig strand G 211..214 CDD:409353 0/2 (0%)
Ig_3 222..311 CDD:464046 22/90 (24%)
FN3 339..431 CDD:238020 17/94 (18%)

Return to query results.
Submit another query.