DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and Tmigd1

DIOPT Version :10

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001128501.1 Gene:Tmigd1 / 363654 RGDID:1307444 Length:261 Species:Rattus norvegicus


Alignment Length:215 Identity:54/215 - (25%)
Similarity:93/215 - (43%) Gaps:43/215 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 KIIWRREDGEEIAVEKKKKVLVYDADVLPLTKVSRNEMGAYLCIATNGV--------PPSVSKRI 234
            :::|.||.| .:.::...|:......|.|:     ||       :.|||        ..:||..:
  Rat    63 ELLWYREAG-RVDLKNGNKINTSSVCVSPI-----NE-------SDNGVSFTCKLQRDQTVSITV 114

  Fly   235 ILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYWV-YNSVMVLPSKKYKTDYTENSYR 298
            :|:|.|.|:: ..|.......|:||.:.|:.:::|:|.:.|. .||.:||...:::...|..|: 
  Rat   115 VLNVTFPPLL-SGNGFQTVEEGSDVRLVCNVKSNPQAQMLWYRNNSALVLEKGRHQIQQTRESF- 177

  Fly   299 AHMKLTIRNLQYGDFGNYRCISKNSL-GETEGSIRVYEIPLPSTPSKQVTHTTVE---------- 352
               :|:|..::..|.|.|.||:.:|| .||.....|.:..:|..|.:.:....|.          
  Rat   178 ---QLSITRVKKSDNGTYNCIASSSLKTETMDFHLVVKDKVPVMPIEPIIAACVVVFLTLAFALL 239

  Fly   353 SRENNII-----PSSRNDTT 367
            ||...|:     .|.||..|
  Rat   240 SRRERIMKLCVKESGRNSET 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG_like 51..143 CDD:214653
Ig strand B 61..65 CDD:409353
Ig strand C 74..78 CDD:409353
Ig strand E 105..112 CDD:409353
Ig strand F 122..127 CDD:409353
Ig strand G 134..137 CDD:409353
Ig 145..238 CDD:472250 15/67 (22%)
Ig strand B 165..169 CDD:409353
Ig strand C 178..182 CDD:409353 0/3 (0%)
Ig strand E 203..207 CDD:409353 1/3 (33%)
Ig strand F 217..222 CDD:409353 0/4 (0%)
Ig strand G 231..234 CDD:409353 1/2 (50%)
Ig 242..333 CDD:472250 26/92 (28%)
Ig strand B 259..263 CDD:409353 1/3 (33%)
Ig strand C 272..276 CDD:409353 0/3 (0%)
Ig strand E 295..305 CDD:409353 2/9 (22%)
Ig strand F 315..320 CDD:409353 2/4 (50%)
Ig strand G 328..331 CDD:409353 0/2 (0%)
Tmigd1NP_001128501.1 IG_like 130..211 CDD:214653 24/84 (29%)
Ig strand B 138..142 CDD:409353 1/3 (33%)
Ig strand C 151..155 CDD:409353 0/3 (0%)
Ig strand E 177..181 CDD:409353 1/7 (14%)
Ig strand F 191..196 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.