DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and Lac

DIOPT Version :9

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster


Alignment Length:315 Identity:89/315 - (28%)
Similarity:146/315 - (46%) Gaps:31/315 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 AQPIPNVTVA-------VGRDANLPCVVEHLGGYKVAWIHIDRQ-MILTIHRHVISRIPRYSITY 103
            ||..|.::..       :|......|.|::...|.|.::..|.. :.|:....::.:..|:|:.|
  Fly    25 AQRTPTISYITQEQIKDIGGTVEFDCSVQYAKEYNVLFLKTDSDPVFLSTGSTLVIKDSRFSLRY 89

  Fly   104 TDN--TWLLHVNQAHQDDRGYYMCQV--NTNPMISQVGYLQVVVPPNILDIESTPSSVAVRENQN 164
            ..|  |:.|.:....:.|.|.|.|||  :|...:|....|.|..||.|.|  ::..||...|...
  Fly    90 DPNSSTYKLQIKDIQETDAGTYTCQVVISTVHKVSAEVKLSVRRPPVISD--NSTQSVVASEGSE 152

  Fly   165 INMTCRADGFPAPKIIWRREDGEEIAVEKKKKVLVYDADVLPLTKVSRNEMGAYLCIATNGVPPS 229
            :.|.|.|.|:|.|.|.||||:...:..:.    ..|..:.|.:..|.:.:.|.|.|:|.|||...
  Fly   153 VQMECYASGYPTPTITWRRENNAILPTDS----ATYVGNTLRIKSVKKEDRGTYYCVADNGVSKG 213

  Fly   230 VSKRIILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYWVYNSVMVLPSKKYK----- 289
            ..:.|.::|||:|:|.||...:|.....|:.::||.||:|...|.|..:.:.:..::.|.     
  Fly   214 DRRNINVEVEFAPVITVPRPRLGQALQYDMDLECHIEAYPPPAIVWTKDDIQLANNQHYSISHFA 278

  Fly   290 --TDYTENSYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIPLPSTP 342
              .:||:::.|.   :|:...||||   |.|.:.|..||.|..:.::|..:|..|
  Fly   279 TADEYTDSTLRV---ITVEKRQYGD---YVCKATNRFGEAEARVNLFETIIPVCP 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 24/103 (23%)
Ig 145..238 CDD:416386 28/92 (30%)
Ig strand A 145..149 CDD:409353 2/3 (67%)
Ig strand A' 154..159 CDD:409353 2/4 (50%)
Ig strand B 165..172 CDD:409353 2/6 (33%)
Ig strand C 178..183 CDD:409353 2/4 (50%)
Ig strand C' 185..187 CDD:409353 0/1 (0%)
Ig strand D 195..199 CDD:409353 0/3 (0%)
Ig strand E 203..209 CDD:409353 1/5 (20%)
Ig strand F 216..223 CDD:409353 3/6 (50%)
Ig strand G 230..238 CDD:409353 1/7 (14%)
Ig 242..333 CDD:416386 28/97 (29%)
Ig strand A' 250..253 CDD:409353 0/2 (0%)
Ig strand B 259..266 CDD:409353 2/6 (33%)
Ig strand C 272..277 CDD:409353 2/4 (50%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 0/10 (0%)
Ig strand E 295..305 CDD:409353 1/9 (11%)
Ig strand F 314..322 CDD:409353 2/7 (29%)
Ig strand G 325..334 CDD:409353 3/8 (38%)
LacNP_523713.2 IG_like 36..131 CDD:214653 22/94 (23%)
FR1 37..50 CDD:409353 1/12 (8%)
Ig strand A' 37..42 CDD:409353 0/4 (0%)
Ig strand B 44..51 CDD:409353 0/6 (0%)
CDR1 51..59 CDD:409353 1/7 (14%)
Ig strand C 59..63 CDD:409353 1/3 (33%)
FR2 60..63 CDD:409353 1/2 (50%)
CDR2 67..81 CDD:409353 1/13 (8%)
Ig strand C' 68..72 CDD:409353 0/3 (0%)
Ig strand C' 79..81 CDD:409353 0/1 (0%)
FR3 84..115 CDD:409353 10/30 (33%)
Ig strand D 84..90 CDD:409353 2/5 (40%)
Ig strand E 94..102 CDD:409353 2/7 (29%)
Ig strand F 108..115 CDD:409353 3/6 (50%)
CDR3 116..124 CDD:409353 1/7 (14%)
FR4 124..130 CDD:409353 1/5 (20%)
Ig strand G 124..130 CDD:409353 1/5 (20%)
Ig_3 134..208 CDD:404760 25/79 (32%)
Ig strand B 153..157 CDD:409353 1/3 (33%)
Ig strand C 166..170 CDD:409353 1/3 (33%)
Ig strand E 187..191 CDD:409353 1/3 (33%)
Ig strand F 201..206 CDD:409353 2/4 (50%)
Ig strand G 215..218 CDD:409353 0/2 (0%)
Ig 227..318 CDD:416386 27/96 (28%)
Ig strand C 256..260 CDD:409353 1/3 (33%)
Ig strand E 286..290 CDD:409353 0/3 (0%)
Ig strand F 300..305 CDD:409353 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - otm40772
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
76.920

Return to query results.
Submit another query.