DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and Sdk2

DIOPT Version :9

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:XP_006247755.1 Gene:Sdk2 / 360652 RGDID:1310397 Length:2175 Species:Rattus norvegicus


Alignment Length:341 Identity:74/341 - (21%)
Similarity:139/341 - (40%) Gaps:56/341 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 MMDEPRFA-QPIPNVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISRIPRYSITY 103
            :::.|:|. :|..::|..:.:..::||..:.:....:.| :.|..::      .:.::.|:. ..
  Rat   307 VLEPPQFVREPERHITAEMEKVVDIPCRAKGVPPPSITW-YKDAALV------EVGKLTRFK-QR 363

  Fly   104 TDNTWLLHVNQAHQDDRGYYMCQVNTNPMISQVG-YLQVV-VPPNIL--DIESTPSSVAVRENQN 164
            :|..  |.::....||.|...|..:.....:|.. ||.|. :.|||.  .::||     |.:..:
  Rat   364 SDGG--LQISGLLPDDTGMVQCFAHNAAGEAQTSTYLAVTSIAPNITRGPLDST-----VIDGMS 421

  Fly   165 INMTCRADGFPAPKIIWRREDGEEI----AVEKKKKVLVYDADVLPLTKVSRNEMGAYLCIATNG 225
            :.:.|...|.|.|.|.|::  ||.|    :|:..:..|:....:| ::....::.|.|.|:||| 
  Rat   422 VVLACETSGAPRPAITWQK--GERILASGSVQLPRFTLLESGSLL-ISPTHISDAGTYTCLATN- 482

  Fly   226 VPPSVSKRIILDVEFSPMIWVPNQLVGAP------SGTDVTIDCHTEAHPKAIIYWVYNSVMVLP 284
                  .|.:.:.....::|...::...|      .||..::.|.....|:..:.:|:       
  Rat   483 ------SRGVDEASADLVVWARTRITKPPQDQSVIKGTQASMVCGVTHDPRVTVRYVW------- 534

  Fly   285 SKKYKTDYTENSYRAHM----KLTIRNLQYGDFGNYRC--ISKNSLGETEGSIRVYEIPLPSTPS 343
            .|...|...|.:.|..:    .|.|.....||.|.|.|  :|..........:||.:  ||..|.
  Rat   535 EKDGATLAVETNPRIRLDRNGSLHISQTWSGDIGTYTCRVLSAGGNDSRNAHLRVRQ--LPHAPE 597

  Fly   344 KQV-THTTVESRENNI 358
            ..| |.:|:|.|..|:
  Rat   598 HPVATLSTMERRAINL 613

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 16/93 (17%)
Ig 145..238 CDD:416386 25/98 (26%)
Ig strand A 145..149 CDD:409353 3/5 (60%)
Ig strand A' 154..159 CDD:409353 0/4 (0%)
Ig strand B 165..172 CDD:409353 1/6 (17%)
Ig strand C 178..183 CDD:409353 2/4 (50%)
Ig strand C' 185..187 CDD:409353 0/1 (0%)
Ig strand D 195..199 CDD:409353 0/3 (0%)
Ig strand E 203..209 CDD:409353 1/5 (20%)
Ig strand F 216..223 CDD:409353 3/6 (50%)
Ig strand G 230..238 CDD:409353 1/7 (14%)
Ig 242..333 CDD:416386 19/102 (19%)
Ig strand A' 250..253 CDD:409353 0/2 (0%)
Ig strand B 259..266 CDD:409353 1/6 (17%)
Ig strand C 272..277 CDD:409353 0/4 (0%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 1/3 (33%)
Ig strand E 295..305 CDD:409353 2/13 (15%)
Ig strand F 314..322 CDD:409353 4/9 (44%)
Ig strand G 325..334 CDD:409353 1/8 (13%)
Sdk2XP_006247755.1 IG_like 43..112 CDD:214653
IGc2 43..101 CDD:197706
IG_like 123..206 CDD:214653
Ig 135..191 CDD:299845
IG_like 225..307 CDD:214653 74/341 (22%)
IGc2 236..289 CDD:197706
I-set 311..400 CDD:254352 18/98 (18%)
Ig 329..397 CDD:143165 12/77 (16%)
I-set 405..495 CDD:254352 25/104 (24%)
Ig 419..495 CDD:299845 19/85 (22%)
Ig 505..589 CDD:299845 18/90 (20%)
IG_like 505..589 CDD:214653 18/90 (20%)
FN3 593..684 CDD:238020 8/21 (38%)
FN3 696..789 CDD:238020
FN3 797..893 CDD:238020
FN3 898..986 CDD:238020
FN3 996..1090 CDD:238020
FN3 1102..1197 CDD:238020
FN3 1204..1293 CDD:238020
FN3 1304..1397 CDD:238020
FN3 1403..1487 CDD:238020
FN3 1506..1619 CDD:238020
FN3 1629..1722 CDD:238020
FN3 1727..1808 CDD:238020
FN3 1840..1919 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.