DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and dpr19

DIOPT Version :10

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_609392.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster


Alignment Length:371 Identity:83/371 - (22%)
Similarity:141/371 - (38%) Gaps:81/371 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PSRFTNRRIMFLIYMTNL---VTHVMMDEPRFAQPIPN---------VTVAVGRDANLPCVVEHL 70
            |.|:......||:.:::.   |..:...:..|...:.:         |....|..|.|||||:..
  Fly     3 PKRWHLHLSCFLLLLSSTFSDVGKITSSQNHFGNTLQSQFNTKNNTRVIAQKGGLAILPCVVKVN 67

  Fly    71 GGYKVAWIHIDRQMILTIHRHVISRIPRYSITYTDNT--WLLHVNQAHQDDRGYYMCQVNTNPMI 133
            ....|:||......:||:.....|...|:.:.:|.:.  |.|.:....::|||:|.||::..|..
  Fly    68 SPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAVREEDRGFYECQLSIYPTQ 132

  Fly   134 SQVGYLQVVVPPNILDIESTPSSVAVRENQNINMTC---RADGFPAPKIIWRREDGEEIAVEKKK 195
            |.|..|::|  ..:.:|.|.| .:.:.|...:.:.|   ||...|| .:.|..:          .
  Fly   133 SIVIELKIV--EAVAEISSAP-ELHIDETSTLRLECKLKRATENPA-FVFWYHD----------S 183

  Fly   196 KVLVYDAD---VLPLTKVSRNEMGAYLCIATNGVPPSVSKRIILDVEFSPMIWVPNQLVGA---- 253
            |::.||:.   |:.....|..:.|.:...:     |:...|..:.:|.|.  .|.|.|:|:    
  Fly   184 KMINYDSQGGFVVTSIGQSNPQSGQFYRSS-----PANKSRATMPMESSN--GVLNSLLGSSDAI 241

  Fly   254 -------PSGTDVTIDCHTEAHPKAIIYWVYNSVMVLPSKKYKTDYTENSYRAHMKLTIRNLQYG 311
                   ||.|...    |:.|..|  |.:..||.|                    ||::.:.:.
  Fly   242 KAPAANVPSSTPYM----TQQHQSA--YLLNPSVSV--------------------LTVKQVNFR 280

  Fly   312 DFGNYRCISKNSLGETEGSIRVYEIPLPSTPSKQVTHTTVESRENN 357
            ..|||.|...|:   ...||.|:.:....|.:.|..:.::...|.|
  Fly   281 HAGNYTCAPSNA---RPASITVHVLRGEKTAAMQHANRSILDTETN 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG_like 51..143 CDD:214653 28/102 (27%)
Ig strand B 61..65 CDD:409353 2/3 (67%)
Ig strand C 74..78 CDD:409353 1/3 (33%)
Ig strand E 105..112 CDD:409353 2/8 (25%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 134..137 CDD:409353 1/2 (50%)
Ig 145..238 CDD:472250 18/98 (18%)
Ig strand B 165..169 CDD:409353 0/3 (0%)
Ig strand C 178..182 CDD:409353 0/3 (0%)
Ig strand E 203..207 CDD:409353 1/6 (17%)
Ig strand F 217..222 CDD:409353 0/4 (0%)
Ig strand G 231..234 CDD:409353 0/2 (0%)
Ig 242..333 CDD:472250 23/101 (23%)
Ig strand B 259..263 CDD:409353 0/3 (0%)
Ig strand C 272..276 CDD:409353 1/3 (33%)
Ig strand E 295..305 CDD:409353 1/9 (11%)
Ig strand F 315..320 CDD:409353 3/4 (75%)
Ig strand G 328..331 CDD:409353 0/2 (0%)
dpr19NP_609392.1 IG_like 50..127 CDD:214653 24/76 (32%)
Ig strand B 58..62 CDD:409353 2/3 (67%)
Ig strand C 71..75 CDD:409353 1/3 (33%)
Ig strand E 107..111 CDD:409353 2/3 (67%)
Ig strand F 121..126 CDD:409353 2/4 (50%)
Ig <265..298 CDD:472250 11/55 (20%)
Ig strand E 270..274 CDD:409551 2/23 (9%)
Ig strand F 284..289 CDD:409551 3/4 (75%)

Return to query results.
Submit another query.