DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and dpr19

DIOPT Version :9

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster


Alignment Length:371 Identity:83/371 - (22%)
Similarity:141/371 - (38%) Gaps:81/371 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PSRFTNRRIMFLIYMTNL---VTHVMMDEPRFAQPIPN---------VTVAVGRDANLPCVVEHL 70
            |.|:......||:.:::.   |..:...:..|...:.:         |....|..|.|||||:..
  Fly     3 PKRWHLHLSCFLLLLSSTFSDVGKITSSQNHFGNTLQSQFNTKNNTRVIAQKGGLAILPCVVKVN 67

  Fly    71 GGYKVAWIHIDRQMILTIHRHVISRIPRYSITYTDNT--WLLHVNQAHQDDRGYYMCQVNTNPMI 133
            ....|:||......:||:.....|...|:.:.:|.:.  |.|.:....::|||:|.||::..|..
  Fly    68 SPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAVREEDRGFYECQLSIYPTQ 132

  Fly   134 SQVGYLQVVVPPNILDIESTPSSVAVRENQNINMTC---RADGFPAPKIIWRREDGEEIAVEKKK 195
            |.|..|::|  ..:.:|.|.| .:.:.|...:.:.|   ||...|| .:.|..:          .
  Fly   133 SIVIELKIV--EAVAEISSAP-ELHIDETSTLRLECKLKRATENPA-FVFWYHD----------S 183

  Fly   196 KVLVYDAD---VLPLTKVSRNEMGAYLCIATNGVPPSVSKRIILDVEFSPMIWVPNQLVGA---- 253
            |::.||:.   |:.....|..:.|.:...:     |:...|..:.:|.|.  .|.|.|:|:    
  Fly   184 KMINYDSQGGFVVTSIGQSNPQSGQFYRSS-----PANKSRATMPMESSN--GVLNSLLGSSDAI 241

  Fly   254 -------PSGTDVTIDCHTEAHPKAIIYWVYNSVMVLPSKKYKTDYTENSYRAHMKLTIRNLQYG 311
                   ||.|...    |:.|..|  |.:..||.|                    ||::.:.:.
  Fly   242 KAPAANVPSSTPYM----TQQHQSA--YLLNPSVSV--------------------LTVKQVNFR 280

  Fly   312 DFGNYRCISKNSLGETEGSIRVYEIPLPSTPSKQVTHTTVESRENN 357
            ..|||.|...|:   ...||.|:.:....|.:.|..:.::...|.|
  Fly   281 HAGNYTCAPSNA---RPASITVHVLRGEKTAAMQHANRSILDTETN 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 28/102 (27%)
Ig 145..238 CDD:416386 18/98 (18%)
Ig strand A 145..149 CDD:409353 0/3 (0%)
Ig strand A' 154..159 CDD:409353 1/4 (25%)
Ig strand B 165..172 CDD:409353 2/9 (22%)
Ig strand C 178..183 CDD:409353 1/4 (25%)
Ig strand C' 185..187 CDD:409353 0/1 (0%)
Ig strand D 195..199 CDD:409353 1/3 (33%)
Ig strand E 203..209 CDD:409353 1/8 (13%)
Ig strand F 216..223 CDD:409353 1/6 (17%)
Ig strand G 230..238 CDD:409353 1/7 (14%)
Ig 242..333 CDD:416386 23/101 (23%)
Ig strand A' 250..253 CDD:409353 1/2 (50%)
Ig strand B 259..266 CDD:409353 0/6 (0%)
Ig strand C 272..277 CDD:409353 1/4 (25%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 0/3 (0%)
Ig strand E 295..305 CDD:409353 1/9 (11%)
Ig strand F 314..322 CDD:409353 4/7 (57%)
Ig strand G 325..334 CDD:409353 2/8 (25%)
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 24/76 (32%)
IGc2 55..125 CDD:197706 21/69 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.