DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and DIP-iota

DIOPT Version :9

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster


Alignment Length:320 Identity:134/320 - (41%)
Similarity:200/320 - (62%) Gaps:9/320 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 EPRFAQPIPNVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISRIPRYSITYTDN- 106
            :|:|:.||.|.||.|||||.|.|||..|..:||||:.:|.|.||:|..|||::..|.||::|:: 
  Fly    30 DPKFSGPINNSTVPVGRDALLTCVVHDLVSFKVAWLRVDTQTILSIQNHVITKNHRISISHTEHR 94

  Fly   107 TWLLHVNQAHQDDRGYYMCQVNTNPMISQVGYLQVVVPPNILDIESTPSSVAVRENQNINMTCRA 171
            .|.|.:....:.|||:||||:||:||.||:|||.|||||:|:|.: |...|.....||:.:||.|
  Fly    95 IWQLKIRDVQESDRGWYMCQINTDPMKSQMGYLDVVVPPDIVDYQ-TSQDVVRSTGQNVTLTCSA 158

  Fly   172 DGFPAPKIIWRREDGEEIAV--EKKKKVLVYDADVLPLTKVSRNEMGAYLCIATNGVPPSVSKRI 234
            .|.|.|.|.||||:...|.:  :..::|...:...|.|.:|.|:.||||||||:|||||:||||:
  Fly   159 TGVPMPTITWRREEATPILISDDGDREVFSVEGQNLTLWQVQRSHMGAYLCIASNGVPPTVSKRV 223

  Fly   235 ILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYWVYNSVMVLPSKKYKTDYTENSYRA 299
            :|.|.|:|.||.....:....|..:|::|.||:.|.::.:|:.:| .:|....|::...::.:|.
  Fly   224 MLVVNFAPTIWTRYDTIYVGLGQKLTLECITESQPASVNFWLRDS-QLLQGGSYESVSVDHVFRI 287

  Fly   300 HMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIPLPSTPSKQVTHTTVESRENNII 359
            .|::|:|.:...|||.|.|.:||::|:|:..|.|:.   .:....|.:|.| .|||:..|
  Fly   288 VMRITLRPITKRDFGEYICRAKNAMGQTDRIITVHH---KAKKHGQHSHQT-SSRESQFI 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 48/92 (52%)
Ig 145..238 CDD:416386 42/94 (45%)
Ig strand A 145..149 CDD:409353 2/3 (67%)
Ig strand A' 154..159 CDD:409353 1/4 (25%)
Ig strand B 165..172 CDD:409353 2/6 (33%)
Ig strand C 178..183 CDD:409353 2/4 (50%)
Ig strand C' 185..187 CDD:409353 0/1 (0%)
Ig strand D 195..199 CDD:409353 1/3 (33%)
Ig strand E 203..209 CDD:409353 2/5 (40%)
Ig strand F 216..223 CDD:409353 6/6 (100%)
Ig strand G 230..238 CDD:409353 5/7 (71%)
Ig 242..333 CDD:416386 27/90 (30%)
Ig strand A' 250..253 CDD:409353 0/2 (0%)
Ig strand B 259..266 CDD:409353 2/6 (33%)
Ig strand C 272..277 CDD:409353 1/4 (25%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 0/3 (0%)
Ig strand E 295..305 CDD:409353 2/9 (22%)
Ig strand F 314..322 CDD:409353 3/7 (43%)
Ig strand G 325..334 CDD:409353 3/8 (38%)
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 44/85 (52%)
Ig 39..122 CDD:299845 42/82 (51%)
Ig 132..213 CDD:299845 33/81 (41%)
IG_like 141..227 CDD:214653 38/85 (45%)
IG_like 239..322 CDD:214653 24/83 (29%)
IGc2 245..313 CDD:197706 21/68 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 40 1.000 Domainoid score I12510
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 128 1.000 Inparanoid score I4644
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D102261at50557
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - otm26286
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
87.870

Return to query results.
Submit another query.