DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and DIP-eta

DIOPT Version :9

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster


Alignment Length:432 Identity:180/432 - (41%)
Similarity:250/432 - (57%) Gaps:30/432 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VVKLLLIALNIFPSRFTNRRIMFLIYMTNLVTHVMMDEPRFAQPIPNVTVAVGRDANLPCVVEHL 70
            ::.|:|::...:|.|            ..:...|::| |:|:.||.|:|..|||||.|.|||:.|
  Fly    18 ILLLILMSQQCYPQR------------VEVPAEVIVD-PKFSSPIVNMTAPVGRDAFLTCVVQDL 69

  Fly    71 GGYKVAWIHIDRQMILTIHRHVISRIPRYSITYTDN-TWLLHVNQAHQDDRGYYMCQVNTNPMIS 134
            |.|||||:.:|.|.||||..|||::..|..|..::: ||.:.:....:.|:|:||||:||:||.|
  Fly    70 GPYKVAWLRVDTQTILTIQNHVITKNQRIGIANSEHKTWTMRIKDIKESDKGWYMCQINTDPMKS 134

  Fly   135 QVGYLQVVVPPNILDIESTPSSVAVRENQNINMTCRADGFPAPKIIWRREDGEEIAVEKKKKVLV 199
            |:|||.|||||:|||. .|.:.:.|||..|:.:.|.|.|.|.|.|.||||.|..|.:...::|:.
  Fly   135 QMGYLDVVVPPDILDY-PTSTDMVVREGSNVTLKCAATGSPEPTITWRRESGVPIELATGEEVMS 198

  Fly   200 YDADVLPLTKVSRNEMGAYLCIATNGVPPSVSKRIILDVEFSPMIWVPNQLVGAPSGTDVTIDCH 264
            .:...|.:..|.|:.||||||||:|||||||||||.|.|.|.|||.|.|||:||..|..||:||.
  Fly   199 IEGTDLVIPNVRRHHMGAYLCIASNGVPPSVSKRITLVVHFPPMITVQNQLIGAVEGKGVTLDCE 263

  Fly   265 TEAHPKAIIYWV-YNSVMVLPSKKYKTDYTE-NSYRAHMKLTIRNLQYGDFGNYRCISKNSLGET 327
            :||:||:|.||. ....:|.|..||..:.|| ..||..|:|.|..|...:||:|||::|||||:|
  Fly   264 SEAYPKSINYWTRERGEIVPPGGKYSANVTEIGGYRNSMRLHINPLTQAEFGSYRCVAKNSLGDT 328

  Fly   328 EGSIRVYEIPLPSTPSKQVTHTTVESRENNIIPSSRNDTTKSLQTDVGYAMKN------DLYPGS 386
            :|:|::|.|| |:..: .|.:.....:......||.:......|...|..|:|      ||..|:
  Fly   329 DGTIKLYRIP-PNAVN-YVENFEARHKGKKRTKSSESHHPARAQEHSGEDMENPGKRKADLSLGA 391

  Fly   387 ASSSSSGGSSSAAS----SSSSMQTSALPGGVA-GNSLSSMG 423
            .|..|..|:|:|.|    ....:....||..|| ..||::.|
  Fly   392 ESIDSIYGNSAAGSRRRQDLGGVLLLLLPVAVAVAMSLATAG 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 47/92 (51%)
Ig 145..238 CDD:416386 45/92 (49%)
Ig strand A 145..149 CDD:409353 2/3 (67%)
Ig strand A' 154..159 CDD:409353 0/4 (0%)
Ig strand B 165..172 CDD:409353 1/6 (17%)
Ig strand C 178..183 CDD:409353 2/4 (50%)
Ig strand C' 185..187 CDD:409353 0/1 (0%)
Ig strand D 195..199 CDD:409353 1/3 (33%)
Ig strand E 203..209 CDD:409353 1/5 (20%)
Ig strand F 216..223 CDD:409353 6/6 (100%)
Ig strand G 230..238 CDD:409353 6/7 (86%)
Ig 242..333 CDD:416386 46/92 (50%)
Ig strand A' 250..253 CDD:409353 1/2 (50%)
Ig strand B 259..266 CDD:409353 4/6 (67%)
Ig strand C 272..277 CDD:409353 3/5 (60%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 0/3 (0%)
Ig strand E 295..305 CDD:409353 4/9 (44%)
Ig strand F 314..322 CDD:409353 4/7 (57%)
Ig strand G 325..334 CDD:409353 4/8 (50%)
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 46/89 (52%)
IG_like 51..137 CDD:214653 43/85 (51%)
IG_like 153..237 CDD:214653 40/83 (48%)
Ig 161..224 CDD:299845 25/62 (40%)
IG_like 252..335 CDD:214653 38/82 (46%)
Ig 258..333 CDD:143165 35/74 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I11903
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 128 1.000 Inparanoid score I4644
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D102333at6960
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - otm26286
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
98.970

Return to query results.
Submit another query.