DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and dpr4

DIOPT Version :10

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster


Alignment Length:218 Identity:60/218 - (27%)
Similarity:89/218 - (40%) Gaps:39/218 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 EPRFAQPI------PNVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISRIPRYSI 101
            |..::||.      ..||..||:.|.|.|.|.:||...|:||......|||:.....:...|:..
  Fly    39 ETPYSQPYFDNSSRREVTATVGQAALLHCRVRNLGDRAVSWIRKRDLHILTVGILTYTNDQRFQS 103

  Fly   102 TYTDNT--WLLHVNQAHQDDRGYYMCQVNTNPMISQVGYLQVVVP-PNILDIESTPSSVAVRENQ 163
            .:::.:  |.|.::.....|.|.|.|||:|.|.|||...|.|||. ..||.    .:.:.::...
  Fly   104 LHSEGSDEWTLRISSPQPRDSGTYECQVSTEPKISQGFRLNVVVSRAKILG----NAELFIKSGS 164

  Fly   164 NINMTCRADGFPAPK--IIWRREDGEEIAVEKKKKVLVYD--------------ADVLPLTKVSR 212
            :||:||.|...|.|.  |.|          .|.|:|:.|.              ...|.:.|.:.
  Fly   165 DINLTCLAMQSPVPPSFIYW----------YKGKRVMNYSQRGGINVITERSTRTSKLLIAKATP 219

  Fly   213 NEMGAYLCIATNGVPPSVSKRII 235
            .:.|.|.|..::....||...:|
  Fly   220 ADSGNYTCSPSSSDSASVVVHVI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG_like 51..143 CDD:214653 32/93 (34%)
Ig strand B 61..65 CDD:409353 2/3 (67%)
Ig strand C 74..78 CDD:409353 1/3 (33%)
Ig strand E 105..112 CDD:409353 2/8 (25%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 134..137 CDD:409353 2/2 (100%)
Ig 145..238 CDD:472250 23/107 (21%)
Ig strand B 165..169 CDD:409353 2/3 (67%)
Ig strand C 178..182 CDD:409353 1/5 (20%)
Ig strand E 203..207 CDD:409353 1/3 (33%)
Ig strand F 217..222 CDD:409353 2/4 (50%)
Ig strand G 231..234 CDD:409353 0/2 (0%)
Ig 242..333 CDD:472250
Ig strand B 259..263 CDD:409353
Ig strand C 272..276 CDD:409353
Ig strand E 295..305 CDD:409353
Ig strand F 315..320 CDD:409353
Ig strand G 328..331 CDD:409353
dpr4NP_001014616.2 IG_like 53..145 CDD:214653 31/91 (34%)
Ig strand A' 55..57 CDD:409355 1/1 (100%)
Ig strand B 61..69 CDD:409355 3/7 (43%)
CDR1 69..75 CDD:409355 3/5 (60%)
Ig strand C 76..82 CDD:409355 3/5 (60%)
CDR2 85..101 CDD:409355 3/15 (20%)
Ig strand D 101..106 CDD:409355 0/4 (0%)
FR3 102..131 CDD:409355 6/28 (21%)
Ig strand E 110..117 CDD:409355 2/6 (33%)
Ig strand F 125..132 CDD:409355 4/6 (67%)
IG_like 161..>227 CDD:214653 17/75 (23%)
Ig strand B 166..170 CDD:409353 2/3 (67%)
Ig strand C 181..185 CDD:409353 2/13 (15%)
Ig strand E 206..214 CDD:409353 1/7 (14%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.