DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and DIP-beta

DIOPT Version :9

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster


Alignment Length:390 Identity:169/390 - (43%)
Similarity:232/390 - (59%) Gaps:38/390 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 MTNLVTHVMMDEPRFAQPIPNVTVAVGRDANLPCVVEHLGGY-----------KVAWIHIDRQMI 85
            ::|.::.|...||.|..|:.|||:|.||||...|||.:|||:           |||||..|.:.|
  Fly    86 VSNKISSVGAFEPDFVIPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAI 150

  Fly    86 LTIHRHVISRIPRYSITYTD-NTWLLHVNQAHQDDRGYYMCQVNTNPMISQVGYLQVVVPPNILD 149
            |.||.|||:...|.|:.:.| |||.|::.....:|.|.|||||||:||..|...|:||:||:|::
  Fly   151 LAIHEHVITNNDRLSVQHNDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQTATLEVVIPPDIIN 215

  Fly   150 IESTPSSVAVRENQNINMTCRADGFPAPKIIWRREDGEEIAV----EKKKKVLVYDADVLPLTKV 210
             |.|...:.|.|..:..:.|||.|.|.|||.||||||.||..    .:|.|....:.::|.|:|:
  Fly   216 -EETSGDMMVPEGGSAKLVCRARGHPKPKITWRREDGREIIARNGSHQKTKAQSVEGEMLTLSKI 279

  Fly   211 SRNEMGAYLCIATNGVPPSVSKRIILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYW 275
            :|:|||||:|||:|||||:||||:.|.|.|.|::.|||||||||..||||:.|:.||.||||.||
  Fly   280 TRSEMGAYMCIASNGVPPTVSKRMKLQVHFHPLVQVPNQLVGAPVLTDVTLICNVEASPKAINYW 344

  Fly   276 V-YNSVMVLPSKKYK-TDYTENSYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIPL 338
            . .|..|::...:|. |:...|.|...|.|.|:.||..|||.|:||||||:|:|||:||:||:  
  Fly   345 QRENGEMIIAGDRYALTEKENNMYAIEMILHIKRLQSSDFGGYKCISKNSIGDTEGTIRLYEM-- 407

  Fly   339 PSTPSKQVTHTTVESRENNIIPSSRNDTT-KSLQTDVGYAMKN---------DLYPGSASSSSSG 393
             ..|.|::.      |::::...|:|:.. |..:::.|....|         |.:|.|.|....|
  Fly   408 -ERPGKKIL------RDDDLNEVSKNEVVQKDTRSEDGSRNLNGRLYKDRAPDQHPASGSDQLLG 465

  Fly   394  393
              Fly   466  465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 48/103 (47%)
Ig 145..238 CDD:416386 46/96 (48%)
Ig strand A 145..149 CDD:409353 2/3 (67%)
Ig strand A' 154..159 CDD:409353 0/4 (0%)
Ig strand B 165..172 CDD:409353 2/6 (33%)
Ig strand C 178..183 CDD:409353 3/4 (75%)
Ig strand C' 185..187 CDD:409353 1/1 (100%)
Ig strand D 195..199 CDD:409353 1/3 (33%)
Ig strand E 203..209 CDD:409353 2/5 (40%)
Ig strand F 216..223 CDD:409353 5/6 (83%)
Ig strand G 230..238 CDD:409353 5/7 (71%)
Ig 242..333 CDD:416386 49/92 (53%)
Ig strand A' 250..253 CDD:409353 2/2 (100%)
Ig strand B 259..266 CDD:409353 3/6 (50%)
Ig strand C 272..277 CDD:409353 3/5 (60%)
Ig strand C' 281..283 CDD:409353 1/1 (100%)
Ig strand D 289..293 CDD:409353 1/4 (25%)
Ig strand E 295..305 CDD:409353 4/9 (44%)
Ig strand F 314..322 CDD:409353 5/7 (71%)
Ig strand G 325..334 CDD:409353 6/8 (75%)
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 51/110 (46%)
ig 102..195 CDD:278476 42/92 (46%)
IG_like 219..307 CDD:214653 42/87 (48%)
Ig 221..307 CDD:299845 42/85 (49%)
Ig 311..404 CDD:299845 49/92 (53%)
IG_like 327..405 CDD:214653 39/77 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I11903
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 128 1.000 Inparanoid score I4644
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - otm26286
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
98.970

Return to query results.
Submit another query.