DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and dpr8

DIOPT Version :10

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_727781.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster


Alignment Length:207 Identity:60/207 - (28%)
Similarity:90/207 - (43%) Gaps:22/207 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PRFAQPI-PNVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISRIPRYSITYTDNT 107
            |.|...| .|:|..||:...|.|.|::||...|:|:......:||:.|:..:...|:...::.:.
  Fly    42 PTFDTTIGTNITGLVGKTVKLTCRVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAMHSPHA 106

  Fly   108 --WLLHVNQAHQDDRGYYMCQVNTNPMISQVGYLQVVVPPNILDIESTPSSVAVRENQNINMTC- 169
              |.|.:..|.:.|.|.|.||::|.|.|....||.:|.|  :.||...| .:.:.....||:|| 
  Fly   107 EDWTLRIRYAQRKDSGIYECQISTTPPIGHSVYLNIVEP--VTDIIGGP-ELHINRGSTINLTCI 168

  Fly   170 -RADGFPAPKIIW--RRE--------DGEEIAVEKKKKVLVYDADVLPLTKVSRNEMGAYLCIAT 223
             :....|.|.:||  .||        .|..:..||.    |.....|.:.|....:.|.|.|..:
  Fly   169 VKFAPEPPPTVIWSHNREIINFDSPRGGISLVTEKG----VLTTSRLLVQKAITQDSGLYTCTPS 229

  Fly   224 NGVPPSVSKRII 235
            |..|.||...|:
  Fly   230 NANPTSVRVHIV 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG_like 51..143 CDD:214653 28/93 (30%)
Ig strand B 61..65 CDD:409353 1/3 (33%)
Ig strand C 74..78 CDD:409353 1/3 (33%)
Ig strand E 105..112 CDD:409353 2/8 (25%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 134..137 CDD:409353 0/2 (0%)
Ig 145..238 CDD:472250 27/103 (26%)
Ig strand B 165..169 CDD:409353 2/3 (67%)
Ig strand C 178..182 CDD:409353 2/5 (40%)
Ig strand E 203..207 CDD:409353 1/3 (33%)
Ig strand F 217..222 CDD:409353 2/4 (50%)
Ig strand G 231..234 CDD:409353 0/2 (0%)
Ig 242..333 CDD:472250
Ig strand B 259..263 CDD:409353
Ig strand C 272..276 CDD:409353
Ig strand E 295..305 CDD:409353
Ig strand F 315..320 CDD:409353
Ig strand G 328..331 CDD:409353
dpr8NP_727781.1 IG_like 51..131 CDD:214653 23/79 (29%)
Ig strand B 60..64 CDD:409353 1/3 (33%)
Ig strand C 73..77 CDD:409353 1/3 (33%)
Ig strand E 109..113 CDD:409353 2/3 (67%)
Ig strand F 123..128 CDD:409353 2/4 (50%)
Ig_3 153..230 CDD:464046 20/81 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.