| Sequence 1: | NP_001097508.2 | Gene: | DIP-delta / 5740816 | FlyBaseID: | FBgn0085420 | Length: | 469 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_727781.1 | Gene: | dpr8 / 32387 | FlyBaseID: | FBgn0052600 | Length: | 344 | Species: | Drosophila melanogaster |
| Alignment Length: | 207 | Identity: | 60/207 - (28%) |
|---|---|---|---|
| Similarity: | 90/207 - (43%) | Gaps: | 22/207 - (10%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 44 PRFAQPI-PNVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISRIPRYSITYTDNT 107
Fly 108 --WLLHVNQAHQDDRGYYMCQVNTNPMISQVGYLQVVVPPNILDIESTPSSVAVRENQNINMTC- 169
Fly 170 -RADGFPAPKIIW--RRE--------DGEEIAVEKKKKVLVYDADVLPLTKVSRNEMGAYLCIAT 223
Fly 224 NGVPPSVSKRII 235 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| DIP-delta | NP_001097508.2 | IG_like | 51..143 | CDD:214653 | 28/93 (30%) |
| Ig strand B | 61..65 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 74..78 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 105..112 | CDD:409353 | 2/8 (25%) | ||
| Ig strand F | 122..127 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 134..137 | CDD:409353 | 0/2 (0%) | ||
| Ig | 145..238 | CDD:472250 | 27/103 (26%) | ||
| Ig strand B | 165..169 | CDD:409353 | 2/3 (67%) | ||
| Ig strand C | 178..182 | CDD:409353 | 2/5 (40%) | ||
| Ig strand E | 203..207 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 217..222 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 231..234 | CDD:409353 | 0/2 (0%) | ||
| Ig | 242..333 | CDD:472250 | |||
| Ig strand B | 259..263 | CDD:409353 | |||
| Ig strand C | 272..276 | CDD:409353 | |||
| Ig strand E | 295..305 | CDD:409353 | |||
| Ig strand F | 315..320 | CDD:409353 | |||
| Ig strand G | 328..331 | CDD:409353 | |||
| dpr8 | NP_727781.1 | IG_like | 51..131 | CDD:214653 | 23/79 (29%) |
| Ig strand B | 60..64 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 73..77 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 109..113 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 123..128 | CDD:409353 | 2/4 (50%) | ||
| Ig_3 | 153..230 | CDD:464046 | 20/81 (25%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||