DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and DIP-kappa

DIOPT Version :9

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster


Alignment Length:448 Identity:190/448 - (42%)
Similarity:267/448 - (59%) Gaps:52/448 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SRFTNRRIMFLIYMTNLVTHVM---------------------------MDEPRFAQPIPNVTVA 56
            :.|..|::...|..|..||.:|                           .|.||||:||.||||:
  Fly    22 AEFNVRQLAITIIATAAVTMLMTATPTLAEIPSKGKHTRLDTQQTAQEDSDFPRFAEPIANVTVS 86

  Fly    57 VGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISRIPRYSITYTDN-TWLLHVNQAHQDDR 120
            |||||.:.||||:|.||||||:.:|.|.||:||.:|||:..|.|:||.|: :|.||:.:..:.||
  Fly    87 VGRDALMACVVENLKGYKVAWVRVDTQTILSIHHNVISQNSRISLTYNDHRSWYLHIKEVEETDR 151

  Fly   121 GYYMCQVNTNPMISQVGYLQVVVPPNILDIESTPSSVAVRENQNINMTCRADGFPAPKIIWRRED 185
            |:|||||||:||.|:.|||||||||.|:: ..|.:.:.|||.|||::.|:|.|:|.|.::|||||
  Fly   152 GWYMCQVNTDPMRSRKGYLQVVVPPIIVE-GLTSNDMVVREGQNISLVCKARGYPEPYVMWRRED 215

  Fly   186 GEEIAVEKKKKVLVYDADVLPLTKVSRNEMGAYLCIATNGVPPSVSKRIILDVEFSPMIWVPNQL 250
            |||:.: ..:.|.|.|.::|.:|||||..|.||||:|:||||||:|||:.|.|:|.||:.:||||
  Fly   216 GEEMLI-GGEHVNVVDGELLHITKVSRLHMAAYLCVASNGVPPSISKRVHLRVQFPPMLSIPNQL 279

  Fly   251 VGAPSGTDVTIDCHTEAHPKAIIYWVYNSVMVLPS------KKYKTDYTENSYRAHMKLTIRNLQ 309
            .||..|.||.::|||||:|.:|.||......::.|      .||:|..|.:.|..:|||.||.:.
  Fly   280 EGAYLGQDVILECHTEAYPASINYWTTERGDMIISDTSRAGDKYETTSTVSGYTKYMKLKIRAVG 344

  Fly   310 YGDFGNYRCISKNSLGETEGSIRVYEIPLPSTPSKQVTHTTVESRENNIIPSSRN--DTTKSLQT 372
            ..|||.|||::|||||||:|:|::.|:|.|:|..  ::..::.:|..:.....||  |:..:| .
  Fly   345 PNDFGTYRCVAKNSLGETDGNIKLDEMPTPTTAI--ISEMSLLNRSYDGKRRHRNKFDSANAL-P 406

  Fly   373 DVGYAMKNDLYPGSASSSSSGGSSSAASSSSSMQTSAL-PGGVAGNSLSSMGSKGSLA 429
            |.|.....|...|          ::|.::..:.||... |.|...||..|:.....||
  Fly   407 DYGVEEWRDGAQG----------NNAGNNGDNNQTPVRNPPGAFHNSAGSLAQHNLLA 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 55/92 (60%)
Ig 145..238 CDD:416386 47/92 (51%)
Ig strand A 145..149 CDD:409353 2/3 (67%)
Ig strand A' 154..159 CDD:409353 0/4 (0%)
Ig strand B 165..172 CDD:409353 2/6 (33%)
Ig strand C 178..183 CDD:409353 1/4 (25%)
Ig strand C' 185..187 CDD:409353 1/1 (100%)
Ig strand D 195..199 CDD:409353 1/3 (33%)
Ig strand E 203..209 CDD:409353 1/5 (20%)
Ig strand F 216..223 CDD:409353 4/6 (67%)
Ig strand G 230..238 CDD:409353 4/7 (57%)
Ig 242..333 CDD:416386 46/96 (48%)
Ig strand A' 250..253 CDD:409353 1/2 (50%)
Ig strand B 259..266 CDD:409353 3/6 (50%)
Ig strand C 272..277 CDD:409353 3/4 (75%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 1/3 (33%)
Ig strand E 295..305 CDD:409353 4/9 (44%)
Ig strand F 314..322 CDD:409353 4/7 (57%)
Ig strand G 325..334 CDD:409353 5/8 (63%)
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 54/91 (59%)
IG_like 82..174 CDD:214653 55/91 (60%)
IG_like 184..267 CDD:214653 44/83 (53%)
IGc2 191..255 CDD:197706 33/64 (52%)
IG_like 282..368 CDD:214653 39/85 (46%)
Ig 288..367 CDD:143165 35/78 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10955
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D102261at50557
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - otm26286
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
87.920

Return to query results.
Submit another query.