DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and Nrg

DIOPT Version :9

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001245581.1 Gene:Nrg / 31792 FlyBaseID:FBgn0264975 Length:1309 Species:Drosophila melanogaster


Alignment Length:373 Identity:92/373 - (24%)
Similarity:145/373 - (38%) Gaps:39/373 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 RYSITYTDNTWLLHVNQAHQDDRGYYMCQVNT---------NPMISQVGYLQVVVP----PNILD 149
            |.::....|.|..:|.:.......||.|...:         |.::..|..:.|...    |.:..
  Fly   185 RMTLDPEGNLWFSNVTREDASSDFYYACSATS
VFRSEYKIGNKVLLDVKQMGVSASQNKHPPVRQ 249

  Fly   150 IESTPSSVAVRENQNINMTCRADGFPAPKIIWRREDGEEIAVEKKKKVLVYDADVLPLTKVSRNE 214
            ..|...|:|:| .:.:.:.|...|.|.|:.:|.: ||:.|....:.....|... |.:.:.:.::
  Fly   250 YVSRRQSLALR-GKRMELFCIYGGTPLPQTVWSK-DGQRIQWSDRITQGHYGKS-LVIRQTNFDD 311

  Fly   215 MGAYLCIATNGVPPSVSKRIILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYWVYNS 279
            .|.|.|..:|||..:.|..|||:|...|......::..|....:|..:|.....|:..|.|::|.
  Fly   312 AGTYTCDVSNGVGNAQSFSIILNVNSVPYFTKEPEIATAAEDEEVVFECRAAGVPEPKISWIHNG 376

  Fly   280 VMVLPSKKYKTDYTENSYRAHMKLTIR--NLQYGDFGNYRCISKNSLGETEGSIRVYEIPLPSTP 342
            ..:..|       |.|..|.....|||  ||..||.|||.|.:.||||.....:.:.....|.|.
  Fly   377 KPIEQS-------TPNPRRTVTDNTIRIINLVKGDTGNYGCNATNSLGYVYKDVYLNVQAEPPTI 434

  Fly   343 SK-QVTHTTVESRENNIIPSSRNDTTKSLQTDVGYAMKNDLYPGSASSSSSGGS---SSAASSSS 403
            |: ....:||:.| |..|....|.:.|.|   |.:...::...|...:..:.|.   .....|.:
  Fly   435 SEAPAAVSTVDGR-NVTIKCRVNGSPKPL---VKWLRASNWLTGGRYNVQANGDLEIQDVTFSDA 495

  Fly   404 SMQTSALPGGVAGNSLSSMGSKGSLAIGKSTFYTERPPN-EYAASSVA 450
            ...|.     .|.|....:.:.|||.:.:.|..|:.|.| |.||...|
  Fly   496 GKYTC-----YAQNKFGEIQADGSLVVKEHTRITQEPQNYEVAAGQSA 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 10/53 (19%)
Ig 145..238 CDD:416386 25/92 (27%)
Ig strand A 145..149 CDD:409353 1/3 (33%)
Ig strand A' 154..159 CDD:409353 1/4 (25%)
Ig strand B 165..172 CDD:409353 1/6 (17%)
Ig strand C 178..183 CDD:409353 1/4 (25%)
Ig strand C' 185..187 CDD:409353 1/1 (100%)
Ig strand D 195..199 CDD:409353 0/3 (0%)
Ig strand E 203..209 CDD:409353 1/5 (20%)
Ig strand F 216..223 CDD:409353 3/6 (50%)
Ig strand G 230..238 CDD:409353 4/7 (57%)
Ig 242..333 CDD:416386 27/92 (29%)
Ig strand A' 250..253 CDD:409353 0/2 (0%)
Ig strand B 259..266 CDD:409353 2/6 (33%)
Ig strand C 272..277 CDD:409353 2/4 (50%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 0/3 (0%)
Ig strand E 295..305 CDD:409353 2/9 (22%)
Ig strand F 314..322 CDD:409353 4/7 (57%)
Ig strand G 325..334 CDD:409353 1/8 (13%)
NrgNP_001245581.1 Ig 55..128 CDD:299845
IG_like 57..127 CDD:214653
Ig 135..214 CDD:299845 7/28 (25%)
IG_like 141..216 CDD:214653 7/30 (23%)
ig 251..332 CDD:278476 21/83 (25%)
I-set 339..427 CDD:254352 27/94 (29%)
Ig 354..427 CDD:299845 25/79 (32%)
I-set 432..517 CDD:254352 20/93 (22%)
Ig 446..517 CDD:299845 16/79 (20%)
I-set 522..611 CDD:254352 7/17 (41%)
ig 525..609 CDD:278476 6/14 (43%)
FN3 613..707 CDD:238020
FN3 716..807 CDD:238020
fn3 817..905 CDD:278470
FN3 917..1004 CDD:238020
FN3 1041..1111 CDD:238020
Bravo_FIGEY 1155..>1221 CDD:290593
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.