Sequence 1: | NP_001097508.2 | Gene: | DIP-delta / 5740816 | FlyBaseID: | FBgn0085420 | Length: | 469 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001245573.1 | Gene: | dpr14 / 31702 | FlyBaseID: | FBgn0029974 | Length: | 340 | Species: | Drosophila melanogaster |
Alignment Length: | 246 | Identity: | 65/246 - (26%) |
---|---|---|---|
Similarity: | 103/246 - (41%) | Gaps: | 40/246 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 FPSRFTNRRIMFLIYMTNLVTHVMMDEPRFAQPIP--NVTVAVGRDANLPCVVEHLGGYKVAWIH 79
Fly 80 I--DRQMILTIHRHVISRIPRYSITYTD-NTWLLHVNQAHQDDRGYYMCQVNTNPMISQVGYLQV 141
Fly 142 VVP-PNILDI--ESTPSSVAVRENQNINMTCRADGFPAPK--IIWRREDGEEIAVEKKKKVLVYD 201
Fly 202 ---------ADVLP--------LTKVSRNEMGAYLCIATNGVPPSVSKRII 235 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DIP-delta | NP_001097508.2 | IG | 51..143 | CDD:214652 | 28/96 (29%) |
Ig | 145..238 | CDD:416386 | 24/112 (21%) | ||
Ig strand A | 145..149 | CDD:409353 | 1/3 (33%) | ||
Ig strand A' | 154..159 | CDD:409353 | 1/4 (25%) | ||
Ig strand B | 165..172 | CDD:409353 | 2/6 (33%) | ||
Ig strand C | 178..183 | CDD:409353 | 2/6 (33%) | ||
Ig strand C' | 185..187 | CDD:409353 | 0/1 (0%) | ||
Ig strand D | 195..199 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 203..209 | CDD:409353 | 3/13 (23%) | ||
Ig strand F | 216..223 | CDD:409353 | 3/6 (50%) | ||
Ig strand G | 230..238 | CDD:409353 | 1/6 (17%) | ||
Ig | 242..333 | CDD:416386 | |||
Ig strand A' | 250..253 | CDD:409353 | |||
Ig strand B | 259..266 | CDD:409353 | |||
Ig strand C | 272..277 | CDD:409353 | |||
Ig strand C' | 281..283 | CDD:409353 | |||
Ig strand D | 289..293 | CDD:409353 | |||
Ig strand E | 295..305 | CDD:409353 | |||
Ig strand F | 314..322 | CDD:409353 | |||
Ig strand G | 325..334 | CDD:409353 | |||
dpr14 | NP_001245573.1 | IG_like | 83..163 | CDD:214653 | 25/79 (32%) |
Ig | 84..169 | CDD:299845 | 25/84 (30%) | ||
IG_like | 191..279 | CDD:214653 | 20/98 (20%) | ||
Ig | 201..274 | CDD:143165 | 18/82 (22%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 46 | 1.000 | Domainoid score | I11916 |
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |