DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and DIP-alpha

DIOPT Version :9

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster


Alignment Length:502 Identity:194/502 - (38%)
Similarity:278/502 - (55%) Gaps:67/502 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RFTN-----RRIMFLIYMTNLVTHVMMDEPRFAQPIPNVTVAVGRDANLPCVVEHLGGYKVAWIH 79
            :||:     :.::.|:.:.:|:..:...:|.|.:.|.||:|||||||...|.|.|||||:|.|:.
  Fly    13 QFTSCDRNGKMLIHLLLIVSLLEAIGAFQPEFVESISNVSVAVGRDATFTCHVRHLGGYRVGWLK 77

  Fly    80 IDRQMILTIHRHVISRIPRYSITYTD-NTWLLHVNQAHQDDRGYYMCQVNTNPMISQVGYLQVVV 143
            .|.:.|..||.:||:..||.::::.| |||.||:....::|||.||||:||:||.||:|:|.||:
  Fly    78 ADTKAIQAIHENVITHNPRVTVSHLDQNTWNLHIKAVSEEDRGGYMCQLNTDPMKSQIGFLDVVI 142

  Fly   144 PPNILDIESTPSSVAVRENQNINMTCRADGFPAPKIIWRREDGEEIAVEKK--KKVLV--YDADV 204
            ||:.:. |.|.|.|.|.|..::.:||||.|:|.|.:.||||||.||.::..  .|.|.  :..:|
  Fly   143 PPDFIS-EDTSSDVIVPEGSSVRLTCRARGYPEPIVTWRREDGNEIVLKDNVGTKTLAPSFRGEV 206

  Fly   205 LPLTKVSRNEMGAYLCIATNGVPPSVSKRIILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHP 269
            |.|:|:||||||:|||||:|||||||||||.|.:.|.|:|.|||||||||.||||.|:||.||.|
  Fly   207 LKLSKISRNEMGSYLCIASNGVPPSVSKRISLSIHFHPVIQVPNQLVGAPLGTDVQIECHVEASP 271

  Fly   270 KAIIYWVYNS-VMVLPSKKYKT-DYTENSYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIR 332
            |:|.||:.:: .|::.|.||.. :.:::.|...|.:.:|..|..|.|:||||:||||||.:.|||
  Fly   272 KSINYWIKDTGEMIVTSGKYHVQESSQSMYETKMSMIVRKFQKDDVGSYRCIAKNSLGEVDSSIR 336

  Fly   333 VYEIPLPS--------------------------TPSKQVTHTTVESRENNIIPSSRNDTTKS-- 369
            :||||.|:                          ...||....|.:..:..:...|..|....  
  Fly   337 LYEIPGPNRNKNPLNGGGKGGGAGGSLDADANDILKQKQQVKVTYQPEDEELQYGSVEDFEAEGG 401

  Fly   370 -------LQTDVGYAMKNDLYPGSASSSSSGGSSSA----------ASSSSSMQTSALPGGVAGN 417
                   |...|.|...|.  |.:....:|||:...          .:::::.|.|..|||  |.
  Fly   402 EGGGLTPLSPHVYYTSGNK--PATHKPGNSGGNQHLHQQHHHHHHHNNNNNNQQHSGGPGG--GP 462

  Fly   418 SLSSMGSKGSLAIGKSTFYTERPPNEYAASS-VAGLLLHRALLFGSG 463
            :....||.|    |:....|.:||..|..:: |.|.:.:..:..|||
  Fly   463 TGGDAGSLG----GEMGGITRKPPPYYGGNTEVRGPIDNNEMSSGSG 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 48/92 (52%)
Ig 145..238 CDD:416386 51/96 (53%)
Ig strand A 145..149 CDD:409353 1/3 (33%)
Ig strand A' 154..159 CDD:409353 2/4 (50%)
Ig strand B 165..172 CDD:409353 3/6 (50%)
Ig strand C 178..183 CDD:409353 1/4 (25%)
Ig strand C' 185..187 CDD:409353 1/1 (100%)
Ig strand D 195..199 CDD:409353 1/3 (33%)
Ig strand E 203..209 CDD:409353 3/5 (60%)
Ig strand F 216..223 CDD:409353 5/6 (83%)
Ig strand G 230..238 CDD:409353 6/7 (86%)
Ig 242..333 CDD:416386 47/92 (51%)
Ig strand A' 250..253 CDD:409353 2/2 (100%)
Ig strand B 259..266 CDD:409353 4/6 (67%)
Ig strand C 272..277 CDD:409353 3/4 (75%)
Ig strand C' 281..283 CDD:409353 1/1 (100%)
Ig strand D 289..293 CDD:409353 0/4 (0%)
Ig strand E 295..305 CDD:409353 2/9 (22%)
Ig strand F 314..322 CDD:409353 5/7 (71%)
Ig strand G 325..334 CDD:409353 5/8 (63%)
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 40/79 (51%)
Ig 51..131 CDD:299845 40/79 (51%)
I-set 144..240 CDD:254352 51/96 (53%)
IGc2 159..228 CDD:197706 34/68 (50%)
Ig 244..337 CDD:299845 47/92 (51%)
I-set 244..337 CDD:254352 47/92 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10955
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 128 1.000 Inparanoid score I4644
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm26286
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
87.970

Return to query results.
Submit another query.