DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and ncam1a

DIOPT Version :9

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:XP_009293555.1 Gene:ncam1a / 30447 ZFINID:ZDB-GENE-990415-31 Length:1010 Species:Danio rerio


Alignment Length:373 Identity:96/373 - (25%)
Similarity:138/373 - (36%) Gaps:95/373 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTVVKLLLIALNIFPS---RFTNRRIMFLIYMTNLVTHVMMDEPRFAQPIPNVTVAVGRDANLPC 65
            |.|:|::   :|:.||   |:|..                           |.|..:.:...|.|
Zfish   198 LRVIKVI---VNVLPSIRTRYTEL---------------------------NATADINQAVTLAC 232

  Fly    66 VVEHLGGY---KVAWIHIDRQMILTIHRHVISRIPRYSITYTDNTWLLHVNQAHQDDRGYYMCQV 127
               |..||   .|.|...:.:         :....:||:....:.  |.:...::.|.|.|.|..
Zfish   233 ---HADGYPEPTVKWARGNTE---------LESDEKYSLNEDGSE--LTIKDVNKLDEGDYKCIA 283

  Fly   128 -NTNPMISQVGYLQVVVPPNILDIESTPSSVAVRENQNINMTCRADGFPAPKIIW---RR----- 183
             |.....|:...|.|.|.|.|..:|:..:|   ...:.|.:||.|.|.|.|.|||   ||     
Zfish   284 RNKAGERSEEVTLNVFVQPKITFLENQTAS---ELEEQITLTCEATGDPTPNIIWSFGRRVFTEN 345

  Fly   184 EDGEEIAVEKKKK-----VLVYDADV--LPLTKVSRNEMGAYLCIATNGVPPSVSKRIILDVEFS 241
            |.......||.|.     |:..||.|  |.|..|...:.|.|||.|.|.:...: :.:.|:|.::
Zfish   346 EQASWTRPEKHKSLDGNVVVRSDARVSSLTLKYVQFTDAGQYLCTARNSIGQDI-QSMYLEVRYA 409

  Fly   242 PMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYWVYNSVMVLPS------KKYKTDYTENSYRAH 300
            |.|..| |.|....|....|.|...|||.|.:.| :.....|||      |.|.|.         
Zfish   410 PKIQGP-QAVFTWEGNPANITCEALAHPGASVLW-FRDGQQLPSANTTNVKIYNTP--------- 463

  Fly   301 MKLTIRNLQ-----YGDFGNYRCISKNSLGETEGSIRVYEIPLPSTPS 343
               |:..|:     ..|||:|.|.:.|.:|.......:.:..:||.||
Zfish   464 ---TVSFLEVTPDSQNDFGSYNCTATNVIGTESKEFILVQADVPSAPS 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 20/95 (21%)
Ig 145..238 CDD:416386 34/107 (32%)
Ig strand A 145..149 CDD:409353 2/3 (67%)
Ig strand A' 154..159 CDD:409353 1/4 (25%)
Ig strand B 165..172 CDD:409353 3/6 (50%)
Ig strand C 178..183 CDD:409353 3/7 (43%)
Ig strand C' 185..187 CDD:409353 0/1 (0%)
Ig strand D 195..199 CDD:409353 2/8 (25%)
Ig strand E 203..209 CDD:409353 3/7 (43%)
Ig strand F 216..223 CDD:409353 4/6 (67%)
Ig strand G 230..238 CDD:409353 1/7 (14%)
Ig 242..333 CDD:416386 28/101 (28%)
Ig strand A' 250..253 CDD:409353 1/2 (50%)
Ig strand B 259..266 CDD:409353 2/6 (33%)
Ig strand C 272..277 CDD:409353 1/4 (25%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 1/3 (33%)
Ig strand E 295..305 CDD:409353 0/9 (0%)
Ig strand F 314..322 CDD:409353 3/7 (43%)
Ig strand G 325..334 CDD:409353 1/8 (13%)
ncam1aXP_009293555.1 Ig 20..112 CDD:299845
I-set 21..111 CDD:254352
IG_like 121..200 CDD:214653 1/1 (100%)
IGc2 128..189 CDD:197706
Ig 208..301 CDD:299845 24/133 (18%)
IG_like 219..298 CDD:214653 19/92 (21%)
Ig 300..406 CDD:299845 35/109 (32%)
IG_like 308..406 CDD:214653 32/101 (32%)
ig 413..498 CDD:278476 26/98 (27%)
IG_like 415..498 CDD:214653 26/96 (27%)
fn3 505..589 CDD:278470 3/4 (75%)
FN3 624..715 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.