DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and PRTG

DIOPT Version :9

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_776175.2 Gene:PRTG / 283659 HGNCID:26373 Length:1150 Species:Homo sapiens


Alignment Length:412 Identity:91/412 - (22%)
Similarity:141/412 - (34%) Gaps:114/412 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 QPIPNVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISRIPRYSITYTDNTWLLHV 112
            ||| :..|..|..|...|.:.......:.|......:.:|:.|  |:.:|         |.:|.:
Human   140 QPI-STEVHEGGVARFACKISSHPPAVITWEFNRTTLPMTMDR--ITALP---------TGVLQI 192

  Fly   113 NQAHQDDRGYYMCQVNTNPMISQVGYLQ-------VVVPPNILDIESTPSSVAVREN------QN 164
            ....|.|.|.|.|      :.:.|.:.:       .|:|........||:.:|..:|      |.
Human   193 YDVSQRDSGNYRC------IAATVAHRRKSMEASLTVIPAKESKSFHTPTIIAGPQNITTSLHQT 251

  Fly   165 INMTCRADGFPAPKIIWRREDGEEIAVEKKKKVLVYDADVLPLTKVSRNEMGAYLCIATNG---- 225
            :.:.|.|.|.|.|.|.|.|.|.:.|.|...:   |.....|.::.|.....|.|:|.||..    
Human   252 VVLECMATGNPKPIISWSRLDHKSIDVFNTR---VLGNGNLMISDVRLQHAGVYVCRATTPGTRN 313

  Fly   226 -----------VPPSVSKRIILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYWVYNS 279
                       .|||.       ||     | |..|....:|| ....|..|..|...:.|:.| 
Human   314 FTVAMATLTVLAPPSF-------VE-----W-PESLTRPRAGT-ARFVCQAEGIPSPKMSWLKN- 363

  Fly   280 VMVLPSKKYKTDYTENSYRAHMKLTIRNLQYGDFGNYRCISKNSLG------------------- 325
                 .:|..::.....|.:  ||.|..:...|...|:|:::||.|                   
Human   364 -----GRKIHSNGRIKMYNS--KLVINQIIPEDDAIYQCMAENSQGSILSRARLTVVMSEDRPSA 421

  Fly   326 ------ETEGS---IRVYEIPLPSTPSKQVTHTT-------VESRENNIIPSSRNDTTKSLQTDV 374
                  ||..|   :..:|.||.:: .|.:.::.       :.:.|..::..  ||||..:..|:
Human   422 PYNVHAETMSSSAILLAWERPLYNS-DKVIAYSVHYMKAEGLNNEEYQVVIG--NDTTHYIIDDL 483

  Fly   375 GYAMKNDLY-----PGSASSSS 391
            ..|.....|     |..||..|
Human   484 EPASNYTFYIVAYMPMGASQMS 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 17/98 (17%)
Ig 145..238 CDD:416386 27/113 (24%)
Ig strand A 145..149 CDD:409353 0/3 (0%)
Ig strand A' 154..159 CDD:409353 1/4 (25%)
Ig strand B 165..172 CDD:409353 1/6 (17%)
Ig strand C 178..183 CDD:409353 2/4 (50%)
Ig strand C' 185..187 CDD:409353 1/1 (100%)
Ig strand D 195..199 CDD:409353 0/3 (0%)
Ig strand E 203..209 CDD:409353 1/5 (20%)
Ig strand F 216..223 CDD:409353 3/6 (50%)
Ig strand G 230..238 CDD:409353 0/7 (0%)
Ig 242..333 CDD:416386 24/118 (20%)
Ig strand A' 250..253 CDD:409353 1/2 (50%)
Ig strand B 259..266 CDD:409353 1/6 (17%)
Ig strand C 272..277 CDD:409353 1/4 (25%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 0/3 (0%)
Ig strand E 295..305 CDD:409353 3/9 (33%)
Ig strand F 314..322 CDD:409353 2/7 (29%)
Ig strand G 325..334 CDD:409353 4/36 (11%)
PRTGNP_776175.2 Ig 40..130 CDD:299845
Ig 139..223 CDD:299845 20/100 (20%)
IG_like 141..223 CDD:214653 19/99 (19%)
IG_like 241..323 CDD:214653 21/84 (25%)
IGc2 250..309 CDD:197706 20/61 (33%)
I-set 327..412 CDD:254352 25/106 (24%)
Ig 345..412 CDD:299845 16/74 (22%)
FN3 419..512 CDD:238020 19/90 (21%)
FN3 517..610 CDD:238020
fn3 624..699 CDD:278470
FN3 726..814 CDD:238020
FN3 821..911 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 981..1002
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1086..1150
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.