DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and dpr7

DIOPT Version :10

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster


Alignment Length:260 Identity:67/260 - (25%)
Similarity:109/260 - (41%) Gaps:48/260 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLIALNIFPSRFTNRRIMFLIYMTNLVTHVMMDEPRFAQPIP-NVTVAVGRDANLPCVVEHLGG 72
            :|::.|||:....:....:.|..:|||      :.|.|....| ||:..|...|.|.|.|::.|.
  Fly    22 ILVLNLNIWCQYISATSYLSLNDLTNL------ERPFFDDISPRNVSAVVDEIAILRCRVKNKGN 80

  Fly    73 YKVAWIHIDRQMILTIHRHVISRIPRYSITYTDNT--WLLHVNQAHQDDRGYYMCQVNTNPMISQ 135
            ..|:|:......|||.:.:..:...|:|:.:...:  |.|.::.|...|.|.|.|||||.|.|:.
  Fly    81 RTVSWMRKRDLHILTTNIYTYTGDQRFSVIHPPGSEDWDLKIDYAQPRDSGVYECQVNTEPKINL 145

  Fly   136 VGYLQVVVPPNILDIES------TPSS---------VAVRENQNINMTCRADGFPAPKIIWRR-- 183
            ...|||:...:..|:::      |.|:         :.|:.:..|.:.|..: ..||.:||..  
  Fly   146 AICLQVIADNDFQDLKTKKRFYDTKSARAKILGSTEIHVKRDSTIALACSVN-IHAPSVIWYHGS 209

  Fly   184 --------EDGEEIAVEKKKKVLVYDADV-----LPLTKVSRNEMGAYLCIATNGVPPSVSKRII 235
                    ..|..:..||        .||     |.||:.|..:.|.|.|:....:|.||...::
  Fly   210 SVVDFDSLRGGISLETEK--------TDVGTTSRLMLTRASLRDSGNYTCVPNGAIPASVRVHVL 266

  Fly   236  235
              Fly   267  266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG_like 51..143 CDD:214653 32/94 (34%)
Ig strand B 61..65 CDD:409353 2/3 (67%)
Ig strand C 74..78 CDD:409353 1/3 (33%)
Ig strand E 105..112 CDD:409353 2/8 (25%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 134..137 CDD:409353 0/2 (0%)
Ig 145..238 CDD:472250 25/121 (21%)
Ig strand B 165..169 CDD:409353 1/3 (33%)
Ig strand C 178..182 CDD:409353 1/3 (33%)
Ig strand E 203..207 CDD:409353 3/8 (38%)
Ig strand F 217..222 CDD:409353 2/4 (50%)
Ig strand G 231..234 CDD:409353 0/2 (0%)
Ig 242..333 CDD:472250
Ig strand B 259..263 CDD:409353
Ig strand C 272..276 CDD:409353
Ig strand E 295..305 CDD:409353
Ig strand F 315..320 CDD:409353
Ig strand G 328..331 CDD:409353
dpr7NP_001096850.2 V-set 56..145 CDD:462230 29/88 (33%)
Ig 184..267 CDD:472250 22/92 (24%)
Ig strand B 190..194 CDD:409353 1/3 (33%)
Ig strand C 202..206 CDD:409353 1/3 (33%)
Ig strand E 234..238 CDD:409353 1/3 (33%)
Ig strand G 261..264 CDD:409353 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.