DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and Cntn6

DIOPT Version :9

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_037357.1 Gene:Cntn6 / 27256 RGDID:62008 Length:1028 Species:Rattus norvegicus


Alignment Length:427 Identity:98/427 - (22%)
Similarity:165/427 - (38%) Gaps:90/427 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIALNIFPSRFTNRRIMFLIYMTNLVTH----------------VMMD-EPRFAQPIPNVTVAVG 58
            |....:.||...|    :..::||...|                ||.: ||:.....|. |:...
  Rat   181 LYIAKVEPSDVGN----YTCFVTNKEAHRSVQGPPTPLVQRTDGVMGEYEPKIEVRFPE-TIQAA 240

  Fly    59 RDANLPCVVEHLGG--YKVAWIHIDRQMILTIHRHVISRIPRYSITYTDNTWLLHVNQAHQDDRG 121
            :|:::......||.  ..::|..:|.           |.:|. .:.|:::...|.:.:..|:|.|
  Rat   241 KDSSVKLECFALGNPVPDISWRRLDG-----------SPMPG-KVKYSNSQATLEIPKFQQEDEG 293

  Fly   122 YYMCQV-NTNPMISQVGYLQVVVPPN-ILDIESTPSSVAVRENQNINMTCRADGFPAPKIIWRRE 184
            :|.|.. |........|.|....||. ...|::|..|:    ..::...|:|.|.|.|...|.: 
  Rat   294 FYECVAGNLRGRNLAKGQLIFYAPPEWEQKIQNTYLSI----YDSLFWECKASGNPNPSYTWLK- 353

  Fly   185 DGEEIAVEKKKKVLVYDADVLPLTKVSRNEMGAYLCIATNGVPPSVSKRIILDVEFSPMIWVPN- 248
            :||.:..|::   :..:...|.:|.::.::.|.|.|.|.|..     :.|..:.|...:...|: 
  Rat   354 NGERLNTEER---IQTENGTLIITMLNVSDSGIYQCAAENKY-----QTIYANAELRVLASAPDF 410

  Fly   249 ------QLVGAPSGTDVTIDCHTEAHPKAIIYWVYNSVMVLPSKKYKTDYTENSYRAHM----KL 303
                  ::.....|.|::|:|...|.|||.|.|           |..|:..:.|.|...    .|
  Rat   411 SKNPIKKISVVQVGGDISIECKPNAFPKASISW-----------KRGTENLKQSKRVFFLEDGSL 464

  Fly   304 TIRNLQYGDFGNYRCISKNSL--GETEGSIRVYEIPLPSTPSKQVTHTTVESRENNIIPS--SRN 364
            .|.|:...|.|:|.|::.|..  |::.||:.|.|..:.:.|..::..|..||   .::|.  |.:
  Rat   465 KICNVTRSDAGSYTCVATNQFGNGKSSGSLIVKERTVITVPPSKMDVTVGES---IVLPCQVSHD 526

  Fly   365 DTTKSL-----QTDVGYAMKNDLYPGSASSSSSGGSS 396
            .|.:.|     ..||     .||..|.|.....||.|
  Rat   527 PTMEVLFVWYFNGDV-----IDLKKGVAHFERIGGES 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 19/94 (20%)
Ig 145..238 CDD:416386 21/93 (23%)
Ig strand A 145..149 CDD:409353 1/4 (25%)
Ig strand A' 154..159 CDD:409353 1/4 (25%)
Ig strand B 165..172 CDD:409353 1/6 (17%)
Ig strand C 178..183 CDD:409353 1/4 (25%)
Ig strand C' 185..187 CDD:409353 0/1 (0%)
Ig strand D 195..199 CDD:409353 0/3 (0%)
Ig strand E 203..209 CDD:409353 1/5 (20%)
Ig strand F 216..223 CDD:409353 3/6 (50%)
Ig strand G 230..238 CDD:409353 1/7 (14%)
Ig 242..333 CDD:416386 26/103 (25%)
Ig strand A' 250..253 CDD:409353 0/2 (0%)
Ig strand B 259..266 CDD:409353 2/6 (33%)
Ig strand C 272..277 CDD:409353 2/4 (50%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 1/3 (33%)
Ig strand E 295..305 CDD:409353 3/13 (23%)
Ig strand F 314..322 CDD:409353 3/7 (43%)
Ig strand G 325..334 CDD:409353 3/8 (38%)
Cntn6NP_037357.1 Ig strand D 76..80 CDD:409353
Ig strand E 82..88 CDD:409353
Ig strand F 95..104 CDD:409353
Ig strand G 107..120 CDD:409353
Ig 129..214 CDD:416386 7/36 (19%)
Ig strand A 130..135 CDD:409353
Ig strand B 139..145 CDD:409353
Ig strand C 153..159 CDD:409353
Ig strand C' 164..166 CDD:409353
Ig strand D 171..176 CDD:409353
Ig strand E 179..183 CDD:409353 1/1 (100%)
Ig strand F 193..201 CDD:409353 2/11 (18%)
Ig strand G 203..214 CDD:409353 1/10 (10%)
Ig 227..315 CDD:416386 20/100 (20%)
Ig strand A 227..232 CDD:409353 1/4 (25%)
Ig strand A' 235..240 CDD:409353 1/5 (20%)
Ig strand B 243..252 CDD:409353 0/8 (0%)
Ig strand C 258..262 CDD:409353 0/3 (0%)
Ig strand C' 265..267 CDD:409353 1/12 (8%)
Ig strand D 276..279 CDD:409353 0/2 (0%)
Ig strand E 280..285 CDD:409353 1/4 (25%)
Ig strand F 293..301 CDD:409353 3/7 (43%)
Ig strand G 304..315 CDD:409353 2/10 (20%)
Ig 319..403 CDD:416386 21/96 (22%)
Ig strand A 319..322 CDD:409353 0/2 (0%)
Ig strand A' 326..330 CDD:409353 1/3 (33%)
Ig strand B 334..342 CDD:409353 1/7 (14%)
Ig strand C 348..353 CDD:409353 1/4 (25%)
Ig strand C' 355..358 CDD:409353 2/2 (100%)
Ig strand D 363..367 CDD:409353 0/6 (0%)
Ig strand E 369..374 CDD:409353 1/4 (25%)
Ig strand F 383..390 CDD:409353 3/6 (50%)
Ig strand G 394..403 CDD:409353 2/8 (25%)
Ig5_Contactin 408..496 CDD:409358 26/98 (27%)
Ig strand B 427..431 CDD:409358 1/3 (33%)
Ig strand C 440..444 CDD:409358 2/14 (14%)
Ig strand E 462..466 CDD:409358 1/3 (33%)
Ig strand F 476..481 CDD:409358 2/4 (50%)
Ig strand G 489..492 CDD:409358 0/2 (0%)
Ig 500..598 CDD:416386 17/67 (25%)
Ig strand A' 507..512 CDD:409353 0/4 (0%)
Ig strand B 515..523 CDD:409353 3/10 (30%)
Ig strand C 532..536 CDD:409353 1/3 (33%)
Ig strand E 560..564 CDD:409353
Ig strand F 573..580 CDD:409353
Ig strand G 587..591 CDD:409353
FN3 598..691 CDD:238020
FN3 703..796 CDD:238020
FN3 805..898 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 887..908
FN3 903..983 CDD:214495
Ig 26..120 CDD:416386
Ig strand A 27..31 CDD:409353
Ig strand A' 34..39 CDD:409353
Ig strand B 45..53 CDD:409353
Ig strand C 58..64 CDD:409353
Ig strand C' 66..69 CDD:409353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.