DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and Cntn6

DIOPT Version :10

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_037357.1 Gene:Cntn6 / 27256 RGDID:62008 Length:1028 Species:Rattus norvegicus


Alignment Length:427 Identity:98/427 - (22%)
Similarity:165/427 - (38%) Gaps:90/427 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIALNIFPSRFTNRRIMFLIYMTNLVTH----------------VMMD-EPRFAQPIPNVTVAVG 58
            |....:.||...|    :..::||...|                ||.: ||:.....|. |:...
  Rat   181 LYIAKVEPSDVGN----YTCFVTNKEAHRSVQGPPTPLVQRTDGVMGEYEPKIEVRFPE-TIQAA 240

  Fly    59 RDANLPCVVEHLGG--YKVAWIHIDRQMILTIHRHVISRIPRYSITYTDNTWLLHVNQAHQDDRG 121
            :|:::......||.  ..::|..:|.           |.:|. .:.|:::...|.:.:..|:|.|
  Rat   241 KDSSVKLECFALGNPVPDISWRRLDG-----------SPMPG-KVKYSNSQATLEIPKFQQEDEG 293

  Fly   122 YYMCQV-NTNPMISQVGYLQVVVPPN-ILDIESTPSSVAVRENQNINMTCRADGFPAPKIIWRRE 184
            :|.|.. |........|.|....||. ...|::|..|:    ..::...|:|.|.|.|...|.: 
  Rat   294 FYECVAGNLRGRNLAKGQLIFYAPPEWEQKIQNTYLSI----YDSLFWECKASGNPNPSYTWLK- 353

  Fly   185 DGEEIAVEKKKKVLVYDADVLPLTKVSRNEMGAYLCIATNGVPPSVSKRIILDVEFSPMIWVPN- 248
            :||.:..|::   :..:...|.:|.::.::.|.|.|.|.|..     :.|..:.|...:...|: 
  Rat   354 NGERLNTEER---IQTENGTLIITMLNVSDSGIYQCAAENKY-----QTIYANAELRVLASAPDF 410

  Fly   249 ------QLVGAPSGTDVTIDCHTEAHPKAIIYWVYNSVMVLPSKKYKTDYTENSYRAHM----KL 303
                  ::.....|.|::|:|...|.|||.|.|           |..|:..:.|.|...    .|
  Rat   411 SKNPIKKISVVQVGGDISIECKPNAFPKASISW-----------KRGTENLKQSKRVFFLEDGSL 464

  Fly   304 TIRNLQYGDFGNYRCISKNSL--GETEGSIRVYEIPLPSTPSKQVTHTTVESRENNIIPS--SRN 364
            .|.|:...|.|:|.|::.|..  |::.||:.|.|..:.:.|..::..|..||   .::|.  |.:
  Rat   465 KICNVTRSDAGSYTCVATNQFGNGKSSGSLIVKERTVITVPPSKMDVTVGES---IVLPCQVSHD 526

  Fly   365 DTTKSL-----QTDVGYAMKNDLYPGSASSSSSGGSS 396
            .|.:.|     ..||     .||..|.|.....||.|
  Rat   527 PTMEVLFVWYFNGDV-----IDLKKGVAHFERIGGES 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG_like 51..143 CDD:214653 19/94 (20%)
Ig strand B 61..65 CDD:409353 0/3 (0%)
Ig strand C 74..78 CDD:409353 0/3 (0%)
Ig strand E 105..112 CDD:409353 1/6 (17%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 134..137 CDD:409353 0/2 (0%)
Ig 145..238 CDD:472250 21/93 (23%)
Ig strand B 165..169 CDD:409353 0/3 (0%)
Ig strand C 178..182 CDD:409353 0/3 (0%)
Ig strand E 203..207 CDD:409353 1/3 (33%)
Ig strand F 217..222 CDD:409353 2/4 (50%)
Ig strand G 231..234 CDD:409353 0/2 (0%)
Ig 242..333 CDD:472250 26/103 (25%)
Ig strand B 259..263 CDD:409353 1/3 (33%)
Ig strand C 272..276 CDD:409353 1/3 (33%)
Ig strand E 295..305 CDD:409353 3/13 (23%)
Ig strand F 315..320 CDD:409353 2/4 (50%)
Ig strand G 328..331 CDD:409353 1/2 (50%)
Cntn6NP_037357.1 Ig 26..120 CDD:472250
Ig strand B 46..50 CDD:409353
Ig strand C 59..63 CDD:409353
Ig strand E 82..86 CDD:409353
Ig strand F 97..102 CDD:409353
Ig strand G 111..114 CDD:409353
Ig 129..214 CDD:472250 7/36 (19%)
Ig strand B 140..144 CDD:409353
Ig strand C 154..158 CDD:409353
Ig strand E 179..183 CDD:409353 1/1 (100%)
Ig strand F 193..198 CDD:409353 1/8 (13%)
Ig strand G 209..212 CDD:409353 0/2 (0%)
Ig 227..315 CDD:472250 20/100 (20%)
Ig strand B 245..249 CDD:409353 0/3 (0%)
Ig strand C 258..262 CDD:409353 0/3 (0%)
Ig strand E 280..284 CDD:409353 1/3 (33%)
Ig strand F 294..299 CDD:409353 2/4 (50%)
Ig strand G 307..310 CDD:409353 0/2 (0%)
Ig 319..403 CDD:472250 21/96 (22%)
Ig strand B 335..339 CDD:143205 0/3 (0%)
Ig strand C 348..352 CDD:143205 0/3 (0%)
Ig strand E 369..373 CDD:143205 1/3 (33%)
Ig strand F 383..388 CDD:143205 2/4 (50%)
Ig strand G 396..399 CDD:143205 0/2 (0%)
Ig5_Contactin 408..496 CDD:409358 26/98 (27%)
Ig strand A 408..413 CDD:409358 1/4 (25%)
Ig strand A' 416..421 CDD:409358 0/4 (0%)
Ig strand B 425..432 CDD:409358 2/6 (33%)
Ig strand C 440..444 CDD:409358 2/14 (14%)
Ig strand D 458..461 CDD:409358 0/2 (0%)
Ig strand E 462..467 CDD:409358 1/4 (25%)
Ig strand F 475..483 CDD:409358 3/7 (43%)
Ig strand G 489..496 CDD:409358 2/6 (33%)
Ig 500..598 CDD:472250 17/67 (25%)
Ig strand B 517..521 CDD:409353 0/3 (0%)
Ig strand C 532..536 CDD:409353 1/3 (33%)
Ig strand E 560..564 CDD:409353
Ig strand F 574..579 CDD:409353
Ig strand G 587..590 CDD:409353
FN3 598..691 CDD:238020
FN3 <620..>912 CDD:442628
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 887..908
FN3 903..983 CDD:214495
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.