| Sequence 1: | NP_001097508.2 | Gene: | DIP-delta / 5740816 | FlyBaseID: | FBgn0085420 | Length: | 469 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_056428.1 | Gene: | LRIT1 / 26103 | HGNCID: | 23404 | Length: | 623 | Species: | Homo sapiens |
| Alignment Length: | 356 | Identity: | 71/356 - (19%) |
|---|---|---|---|
| Similarity: | 126/356 - (35%) | Gaps: | 98/356 - (27%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 25 RIMFLIYMTNLVTHVMMDEPRFAQPIPNVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIH 89
Fly 90 RHVISRIPRYSITYTDNTW--------LLHVNQAHQDDRGYYMCQVN-TNP-MISQVGYLQV--- 141
Fly 142 -----VVPPNILDIESTPSSVAVRENQNINMTCRADGFPAPKIIWRREDGEEIAVEKKKKVLVYD 201
Fly 202 AD-----VLPLTKVSRNEMGAYLCIATN--GVPPSVSKRIILDVEFSP-------MIWV------ 246
Fly 247 -----PNQLVGAPSGTDVTIDCHTEAHPKAIIYWVYNSVMVLPSKKYKTDYTENSYRAHMKLTIR 306
Fly 307 NLQYGDFGNYRCISKNSLGETEG----SIRV 333 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| DIP-delta | NP_001097508.2 | IG | 51..143 | CDD:214652 | 17/109 (16%) |
| Ig | 145..238 | CDD:416386 | 27/99 (27%) | ||
| Ig strand A | 145..149 | CDD:409353 | 1/3 (33%) | ||
| Ig strand A' | 154..159 | CDD:409353 | 0/4 (0%) | ||
| Ig strand B | 165..172 | CDD:409353 | 1/6 (17%) | ||
| Ig strand C | 178..183 | CDD:409353 | 1/4 (25%) | ||
| Ig strand C' | 185..187 | CDD:409353 | 0/1 (0%) | ||
| Ig strand D | 195..199 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 203..209 | CDD:409353 | 3/10 (30%) | ||
| Ig strand F | 216..223 | CDD:409353 | 3/6 (50%) | ||
| Ig strand G | 230..238 | CDD:409353 | 2/7 (29%) | ||
| Ig | 242..333 | CDD:416386 | 20/112 (18%) | ||
| Ig strand A' | 250..253 | CDD:409353 | 2/2 (100%) | ||
| Ig strand B | 259..266 | CDD:409353 | 1/6 (17%) | ||
| Ig strand C | 272..277 | CDD:409353 | 0/4 (0%) | ||
| Ig strand C' | 281..283 | CDD:409353 | 0/1 (0%) | ||
| Ig strand D | 289..293 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 295..305 | CDD:409353 | 1/9 (11%) | ||
| Ig strand F | 314..322 | CDD:409353 | 2/7 (29%) | ||
| Ig strand G | 325..334 | CDD:409353 | 4/13 (31%) | ||
| LRIT1 | NP_056428.1 | LRR 1 | 60..81 | ||
| leucine-rich repeat | 61..84 | CDD:275378 | |||
| LRR_8 | 63..143 | CDD:290566 | 2/10 (20%) | ||
| LRR 2 | 84..105 | ||||
| leucine-rich repeat | 85..132 | CDD:275378 | 71/356 (20%) | ||
| LRR 3 | 108..129 | ||||
| LRR_8 | 131..202 | CDD:290566 | 15/81 (19%) | ||
| LRR_4 | 131..171 | CDD:289563 | 5/38 (13%) | ||
| LRR 4 | 132..153 | 3/20 (15%) | |||
| leucine-rich repeat | 133..156 | CDD:275378 | 5/22 (23%) | ||
| LRR 5 | 156..177 | 3/26 (12%) | |||
| leucine-rich repeat | 157..180 | CDD:275378 | 5/28 (18%) | ||
| leucine-rich repeat | 181..205 | CDD:275378 | 6/29 (21%) | ||
| TPKR_C2 | 201..>240 | CDD:301599 | 5/38 (13%) | ||
| Ig | 267..345 | CDD:299845 | 23/87 (26%) | ||
| IG_like | 267..345 | CDD:214653 | 23/87 (26%) | ||
| FN3 | 431..498 | CDD:214495 | 2/6 (33%) | ||
| LRR 6. /evidence=ECO:0000305 | 571..594 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||