DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and Cadm4

DIOPT Version :10

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_694752.1 Gene:Cadm4 / 260299 MGIID:2449088 Length:388 Species:Mus musculus


Alignment Length:282 Identity:67/282 - (23%)
Similarity:112/282 - (39%) Gaps:22/282 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 NVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISRIPRYSI-TYTDNTWLLHVNQA 115
            |||||.|..|.:.|.:....|..|...:..||.:.......: :..|:.: .::.....:.::.|
Mouse    31 NVTVAEGGVAEITCRLHQYDGSIVVIQNPARQTLFFNGTRAL-KDERFQLEEFSPRRVRIRLSDA 94

  Fly   116 HQDDRGYYMCQVNTNPMISQVGYLQVVVPPNILDIESTPSSVAVRENQNINMTCRAD-GFPAPKI 179
            ..:|.|.|.||:.|.....|:..|.|:|.|....:|....:|   |...:.::|... ..||..:
Mouse    95 RLEDEGGYFCQLYTEDTHHQIATLTV
LVAPENPVVEVREQAV---EGGEVELSCLVPRSRPAAVL 156

  Fly   180 IWRREDGEEIAVEK-KKKVLVYDADVLPLTKVSR-NEMGAYLCIATN-GVPPSVSK--RIILDVE 239
            .|.|:..|...|.. ::...|:........:|.| ::.|..:|.|.| .:|...||  :.:|||:
Mouse   157 RWYRDRKELKGVSSGQENGKVWSVASTVRFRVDRKDDGGIVICEAQNQALPSGHSKQTQYVLDVQ 221

  Fly   240 FSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKA-IIYWVYNSVMVLPSKKYKTDYTENSYRAHMKL 303
            :||...:.........|..:.:.|....:|:. .|.|...:.. ||.:......|         |
Mouse   222 YSPTARIHASQAVVREGDTLVLTCAVTGNPRPNQIRWNRGNES-LPERAEAVGET---------L 276

  Fly   304 TIRNLQYGDFGNYRCISKNSLG 325
            |:..|...|.|.|.|.:.|..|
Mouse   277 TLPGLVSADNGTYTCEAANKHG 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG_like 51..143 CDD:214653 23/91 (25%)
Ig strand B 61..65 CDD:409353 1/3 (33%)
Ig strand C 74..78 CDD:409353 1/3 (33%)
Ig strand E 105..112 CDD:409353 0/6 (0%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 134..137 CDD:409353 1/2 (50%)
Ig 145..238 CDD:472250 22/98 (22%)
Ig strand B 165..169 CDD:409353 0/3 (0%)
Ig strand C 178..182 CDD:409353 0/3 (0%)
Ig strand E 203..207 CDD:409353 0/3 (0%)
Ig strand F 217..222 CDD:409353 1/4 (25%)
Ig strand G 231..234 CDD:409353 2/4 (50%)
Ig 242..333 CDD:472250 18/85 (21%)
Ig strand B 259..263 CDD:409353 0/3 (0%)
Ig strand C 272..276 CDD:409353 1/3 (33%)
Ig strand E 295..305 CDD:409353 1/9 (11%)
Ig strand F 315..320 CDD:409353 2/4 (50%)
Ig strand G 328..331 CDD:409353
Cadm4NP_694752.1 Ig 29..120 CDD:472250 22/89 (25%)
Ig strand B 40..44 CDD:409465 1/3 (33%)
Ig strand C 53..57 CDD:409465 1/3 (33%)
Ig strand E 87..91 CDD:409465 0/3 (0%)
Ig strand F 101..106 CDD:409465 2/4 (50%)
Ig strand G 113..116 CDD:409465 1/2 (50%)
IgI_2_Necl-4 121..220 CDD:409468 23/101 (23%)
Ig strand A 121..124 CDD:409468 1/2 (50%)
Ig strand A' 127..131 CDD:409468 0/3 (0%)
Ig strand B 139..149 CDD:409468 1/9 (11%)
Ig strand C 152..161 CDD:409468 3/8 (38%)
Ig strand C' 162..165 CDD:409468 0/2 (0%)
Ig strand D 167..174 CDD:409468 1/6 (17%)
Ig strand E 177..187 CDD:409468 1/9 (11%)
Ig strand F 195..203 CDD:409468 3/7 (43%)
Ig strand G 212..219 CDD:409468 1/6 (17%)
Ig_3 224..295 CDD:464046 16/80 (20%)
4.1m 344..362 CDD:128590
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.