DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and Ncam1

DIOPT Version :9

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:XP_038936733.1 Gene:Ncam1 / 24586 RGDID:67378 Length:1136 Species:Rattus norvegicus


Alignment Length:497 Identity:115/497 - (23%)
Similarity:183/497 - (36%) Gaps:123/497 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 GRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISRIPRYSITYTDNTWLLHVNQAHQDDRGY 122
            |.||.:.|.|.......:.|.|..|.:||       .:..|: |..::|  .|.:....:.|.|.
  Rat   132 GEDAVIVCDVVSSLPPTIIWKHKGRDVIL-------KKDVRF-IVLSNN--YLQIRGIKKTDEGT 186

  Fly   123 YMC--------QVNTNPMISQVGYLQVV--VPPNILDIESTPSSVAVRENQNINMTCRADGFPAP 177
            |.|        ::|...       :||:  |||.:...:|..::.| ...|::.:.|.|||||.|
  Rat   187 YRCEG
RILARGEINFKD-------IQVIVNVPPTVQARQSIVNATA-NLGQSVTLVCDADGFPEP 243

  Fly   178 KIIWRREDGEEIAVEK---KKKVLVYDADVLPLTKVSRNEMGAYLCIATNGVPPSVSKRIILDVE 239
            .:.|.: |||.|..|:   :|.:...|:..|.:..|.:|:...|:|||.|..... ...|.|.|.
  Rat   244 TMSWTK-DGEPIENEEEDDEKHIFSDDSSELTIRNVDKNDEAEYVCIAENKAGEQ-DASIHLKVF 306

  Fly   240 FSPMI-WVPNQLVGAPSGTDVTIDCHTEAHPKAIIYWVYNSVMVLPSKKYKTDYT----ENSYRA 299
            ..|.| :|.|| ........||:.|.....|...|.|..::..:  |.:.|..:|    :.:...
  Rat   307 AKPKITYVENQ-TAMELEEQVTLTCEASGDPIPSITWRTSTRNI--SSEEKASWTRPEKQETLDG 368

  Fly   300 HM---------KLTIRNLQYGDFGNYRCISKNSLGE--------------TEGSIRVYEIPLPST 341
            ||         .||::::||.|.|.|.|.:.|::|:              .:|.:.||     :.
  Rat   369 HMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQGPVAVY-----TW 428

  Fly   342 PSKQVTHT---------TVE-SRENNIIPSSRNDTTKSLQT------DVGYAMKND--------- 381
            ...||..|         |:. .|:..::|||.....|...|      :|....:||         
  Rat   429 EGNQVNITCEVFAYPSATISWFRDGQLLPSSNYSNIKIYNTPSASYLEVTPDSENDFGNYNCTAV 493

  Fly   382 -----------LYPGSASSSSSGGSSSAASSSSSMQTSALPGGVAGNSL-------SSMGSKGSL 428
                       |......||.|.......||::.:|... |....|..:       .|:|.:.  
  Rat   494 NRIGQESLEFILVQADTPSSPSIDRVEPYSSTAQVQFDE-PEATGGVPILKYKAEWKSLGEEA-- 555

  Fly   429 AIGKSTFYTERPPNEYAASSVAGL------LLHRALLFGSGI 464
              ..|.:|..:..|.....::.||      .:..|.|.|.|:
  Rat   556 --WHSKWYDAKEANMEGIVTIMGLKPETRYAVRLAALNGKGL 595

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 21/94 (22%)
Ig 145..238 CDD:416386 29/95 (31%)
Ig strand A 145..149 CDD:409353 1/3 (33%)
Ig strand A' 154..159 CDD:409353 0/4 (0%)
Ig strand B 165..172 CDD:409353 1/6 (17%)
Ig strand C 178..183 CDD:409353 1/4 (25%)
Ig strand C' 185..187 CDD:409353 1/1 (100%)
Ig strand D 195..199 CDD:409353 1/3 (33%)
Ig strand E 203..209 CDD:409353 1/5 (20%)
Ig strand F 216..223 CDD:409353 3/6 (50%)
Ig strand G 230..238 CDD:409353 2/7 (29%)
Ig 242..333 CDD:416386 27/118 (23%)
Ig strand A' 250..253 CDD:409353 0/2 (0%)
Ig strand B 259..266 CDD:409353 3/6 (50%)
Ig strand C 272..277 CDD:409353 2/4 (50%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 1/3 (33%)
Ig strand E 295..305 CDD:409353 3/18 (17%)
Ig strand F 314..322 CDD:409353 3/7 (43%)
Ig strand G 325..334 CDD:409353 2/22 (9%)
Ncam1XP_038936733.1 IgI_1_NCAM-1 20..116 CDD:409451
Ig strand B 37..41 CDD:409451
Ig strand C 51..55 CDD:409451
Ig strand E 79..83 CDD:409451
Ig strand F 93..98 CDD:409451
Ig strand G 107..110 CDD:409451
IG_like 124..190 CDD:214653 17/67 (25%)
Ig strand B 135..139 CDD:409353 1/3 (33%)
Ig strand C 148..152 CDD:409353 0/3 (0%)
Ig strand E 172..176 CDD:409353 2/5 (40%)
Ig strand F 186..191 CDD:409353 2/4 (50%)
IgI_3_NCAM-1 211..308 CDD:143207 31/99 (31%)
Ig strand B 231..235 CDD:143207 0/3 (0%)
Ig strand C 244..248 CDD:143207 0/3 (0%)
Ig strand E 271..275 CDD:143207 1/3 (33%)
Ig strand F 285..290 CDD:143207 2/4 (50%)
Ig strand G 298..301 CDD:143207 0/2 (0%)
IgI_NCAM-1 307..413 CDD:143277 26/108 (24%)
Ig strand B 326..330 CDD:143277 2/3 (67%)
Ig strand C 339..343 CDD:143277 1/3 (33%)
Ig strand E 379..383 CDD:143277 1/3 (33%)
Ig strand F 393..398 CDD:143277 2/4 (50%)
Ig strand G 406..409 CDD:143277 0/2 (0%)
Ig_3 422..494 CDD:404760 15/76 (20%)
Ig strand B 433..437 CDD:409353 1/3 (33%)
Ig strand C 446..450 CDD:409353 1/3 (33%)
Ig strand E 473..477 CDD:409353 0/3 (0%)
Ig strand F 487..492 CDD:409353 0/4 (0%)
FN3 509..606 CDD:238020 19/92 (21%)
fn3 619..701 CDD:394996
Herpes_BLLF1 <842..1133 CDD:282904
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.