Sequence 1: | NP_001097508.2 | Gene: | DIP-delta / 5740816 | FlyBaseID: | FBgn0085420 | Length: | 469 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001274153.1 | Gene: | Lrit3 / 242235 | MGIID: | 2685267 | Length: | 681 | Species: | Mus musculus |
Alignment Length: | 394 | Identity: | 75/394 - (19%) |
---|---|---|---|
Similarity: | 139/394 - (35%) | Gaps: | 120/394 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 86 LTIHRHVISRIPRYSITYTDNTWLLHVNQAHQDDRGYYMCQVNTNPMISQVGYLQVVVPPNILD- 149
Fly 150 ---IESTPSSVAVRENQNINMTCRADGFPAPKIIWRREDGE---EIAVEKKKKVLVYDADVLPLT 208
Fly 209 KVSRNEM----GAYLCIATNGVPPSVSKRIILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHP 269
Fly 270 KAIIYWV--------YNSVMVLPSKKYKTDYTENSYRAHMKLTIRNLQYGDFGNYRCISKNSLGE 326
Fly 327 TEGSIRVYEI-PLPSTPSKQVTHTTV-ESRENNIIPSSRNDTTKSLQTDVGYAMKNDLYPGSASS 389
Fly 390 SSSGGSS-------------------SAASSSSSMQTSAL--------------PGGVAGNSLSS 421
Fly 422 MGSK 425 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DIP-delta | NP_001097508.2 | IG | 51..143 | CDD:214652 | 8/56 (14%) |
Ig | 145..238 | CDD:416386 | 20/103 (19%) | ||
Ig strand A | 145..149 | CDD:409353 | 1/3 (33%) | ||
Ig strand A' | 154..159 | CDD:409353 | 2/4 (50%) | ||
Ig strand B | 165..172 | CDD:409353 | 1/6 (17%) | ||
Ig strand C | 178..183 | CDD:409353 | 2/4 (50%) | ||
Ig strand C' | 185..187 | CDD:409353 | 1/1 (100%) | ||
Ig strand D | 195..199 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 203..209 | CDD:409353 | 2/5 (40%) | ||
Ig strand F | 216..223 | CDD:409353 | 1/6 (17%) | ||
Ig strand G | 230..238 | CDD:409353 | 2/7 (29%) | ||
Ig | 242..333 | CDD:416386 | 18/98 (18%) | ||
Ig strand A' | 250..253 | CDD:409353 | 0/2 (0%) | ||
Ig strand B | 259..266 | CDD:409353 | 2/6 (33%) | ||
Ig strand C | 272..277 | CDD:409353 | 1/12 (8%) | ||
Ig strand C' | 281..283 | CDD:409353 | 0/1 (0%) | ||
Ig strand D | 289..293 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 295..305 | CDD:409353 | 0/9 (0%) | ||
Ig strand F | 314..322 | CDD:409353 | 4/7 (57%) | ||
Ig strand G | 325..334 | CDD:409353 | 2/8 (25%) | ||
Lrit3 | NP_001274153.1 | LRR 1. /evidence=ECO:0000255 | 56..79 | ||
LRR_8 | 61..117 | CDD:290566 | |||
LRR 2. /evidence=ECO:0000255 | 80..103 | ||||
leucine-rich repeat | 83..106 | CDD:275378 | |||
LRR 3. /evidence=ECO:0000255 | 104..128 | ||||
LRR_8 | 105..165 | CDD:290566 | 8/45 (18%) | ||
LRR_4 | 106..146 | CDD:289563 | 3/11 (27%) | ||
leucine-rich repeat | 107..130 | CDD:275378 | |||
LRR_4 | 129..170 | CDD:289563 | 8/58 (14%) | ||
LRR 4. /evidence=ECO:0000255 | 129..151 | 4/16 (25%) | |||
leucine-rich repeat | 131..154 | CDD:275378 | 5/19 (26%) | ||
LRR 5. /evidence=ECO:0000255 | 152..175 | 6/45 (13%) | |||
leucine-rich repeat | 155..168 | CDD:275378 | 2/35 (6%) | ||
Ig | 254..335 | CDD:299845 | 16/90 (18%) | ||
IG_like | 263..339 | CDD:214653 | 16/85 (19%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 350..391 | 11/49 (22%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 425..464 | 9/37 (24%) | |||
FN3 | 489..563 | CDD:238020 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |