| Sequence 1: | NP_001097508.2 | Gene: | DIP-delta / 5740816 | FlyBaseID: | FBgn0085420 | Length: | 469 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_666357.2 | Gene: | Lrit1 / 239037 | MGIID: | 2385320 | Length: | 624 | Species: | Mus musculus |
| Alignment Length: | 366 | Identity: | 74/366 - (20%) |
|---|---|---|---|
| Similarity: | 126/366 - (34%) | Gaps: | 114/366 - (31%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 77 WIHIDRQMILTIHRHVISRIPRYSITYTDNTWLLHVNQAHQDDRGYYMCQVNTNPMISQVGYLQV 141
Fly 142 VVPPNILDIE-----STPSSVA--------VRENQN-----------------INMTCRADGFPA 176
Fly 177 PKIIWRREDG--------EEIAVEKKKKVLVYDADVLPLTKVSRNEMGAYLCIATNGVPPSVSKR 233
Fly 234 IILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYWVYNSVMVLPSKKYKTDYTENSYR 298
Fly 299 AHM-----KLTIRNLQY---GDFGN--------YRCISKNSLGETEGSIR-VYEIPLPSTPSKQV 346
Fly 347 THTTV-----------ESRENNIIPSSRNDTTKSLQTDVGY 376 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| DIP-delta | NP_001097508.2 | IG | 51..143 | CDD:214652 | 13/65 (20%) |
| Ig | 145..238 | CDD:416386 | 30/130 (23%) | ||
| Ig strand A | 145..149 | CDD:409353 | 1/3 (33%) | ||
| Ig strand A' | 154..159 | CDD:409353 | 3/12 (25%) | ||
| Ig strand B | 165..172 | CDD:409353 | 1/6 (17%) | ||
| Ig strand C | 178..183 | CDD:409353 | 1/4 (25%) | ||
| Ig strand C' | 185..187 | CDD:409353 | 1/9 (11%) | ||
| Ig strand D | 195..199 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 203..209 | CDD:409353 | 2/5 (40%) | ||
| Ig strand F | 216..223 | CDD:409353 | 3/6 (50%) | ||
| Ig strand G | 230..238 | CDD:409353 | 2/7 (29%) | ||
| Ig | 242..333 | CDD:416386 | 19/107 (18%) | ||
| Ig strand A' | 250..253 | CDD:409353 | 0/2 (0%) | ||
| Ig strand B | 259..266 | CDD:409353 | 0/6 (0%) | ||
| Ig strand C | 272..277 | CDD:409353 | 0/4 (0%) | ||
| Ig strand C' | 281..283 | CDD:409353 | 0/1 (0%) | ||
| Ig strand D | 289..293 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 295..305 | CDD:409353 | 2/14 (14%) | ||
| Ig strand F | 314..322 | CDD:409353 | 1/15 (7%) | ||
| Ig strand G | 325..334 | CDD:409353 | 3/9 (33%) | ||
| Lrit1 | NP_666357.2 | LRRNT | 23..61 | CDD:214470 | |
| LRR 1 | 60..81 | ||||
| LRR_8 | 63..143 | CDD:290566 | |||
| leucine-rich repeat | 64..84 | CDD:275378 | |||
| LRR 2 | 84..105 | ||||
| leucine-rich repeat | 85..132 | CDD:275378 | |||
| LRR 3 | 108..129 | ||||
| LRR_8 | 131..>176 | CDD:290566 | |||
| LRR_4 | 131..172 | CDD:289563 | |||
| LRR 4 | 132..153 | ||||
| leucine-rich repeat | 133..156 | CDD:275378 | |||
| LRR 5 | 156..177 | ||||
| leucine-rich repeat | 157..180 | CDD:275378 | 1/1 (100%) | ||
| leucine-rich repeat | 181..205 | CDD:275378 | 6/29 (21%) | ||
| TPKR_C2 | 201..>241 | CDD:301599 | 13/57 (23%) | ||
| Ig | 258..346 | CDD:299845 | 23/100 (23%) | ||
| IG_like | 268..346 | CDD:214653 | 23/90 (26%) | ||
| FN3 | 432..502 | CDD:214495 | 14/71 (20%) | ||
| LRR 6 | 526..549 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||