DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and Ntm

DIOPT Version :9

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001344522.1 Gene:Ntm / 235106 MGIID:2446259 Length:367 Species:Mus musculus


Alignment Length:366 Identity:102/366 - (27%)
Similarity:159/366 - (43%) Gaps:52/366 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 VMMDEPRFAQPIPNVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISRIPR-YSIT 102
            |...:..|.:.:.||||..|..|.|.|.::: ...:|||  ::|..||..........|| ..::
Mouse    31 VRSGDATFPKAMDNVTVRQGESATLRCTIDN-RVTRVAW--LNRSTILYAGNDKWCLDPRVVLLS 92

  Fly   103 YTDNTWLLHVNQAHQDDRGYYMCQVNT--NPMISQVGYLQVVVPPNILDIESTPSSVAVRENQNI 165
            .|...:.:.:......|.|.|.|.|.|  :|..|:| :|.|.|.|.|::|.   |.:::.|..||
Mouse    93 NTQTQYSIEIQNVDVYDEGPYTCSVQTDNHPKTSRV-HLIVQVSPKIVEIS---SDISINEGNNI 153

  Fly   166 NMTCRADGFPAPKIIWRREDGEEIAVEKKKKVLVYDADVLPLTKVSRNEMGAYLCIATNGVPPSV 230
            ::||.|.|.|.|.:.||.       :..|....|.:.:.|.:..::|.:.|.|.|.|:|.|...|
Mouse   154 SLTCIATGRPEPTVTWRH-------ISPKAVGFVSEDEYLEIQGITREQSGEYECSASNDVAAPV 211

  Fly   231 SKRIILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYWVYNSVMVLPSKKYKTDYTEN 295
            .:|:.:.|.:.|.| ...:..|.|.|...|:.|...|.|.|...|..:...::..||...  .||
Mouse   212 VRRVKVTVNYPPYI-SEAKGTGVPVGQKGTLQCEASAVPSAEFQWFKDDKRLVEGKKGVK--VEN 273

  Fly   296 SYRAHM-KLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEI--PLPSTPSKQVTHTTVESRENN 357
              |..: |||..|:...|:|||.|::.|.||.|..||.::|:  |..||..::|..|.:...:. 
Mouse   274 --RPFLSKLTFFNVSEHDYGNYTCVASNKLGHTNASIMLFELNEPTSSTLLQEVKTTALTPWKG- 335

  Fly   358 IIPSSRNDTTKSLQTDVGYAMKNDLYPGSASSSSSGGSSSA 398
                                      ||:.|..::|.|..|
Mouse   336 --------------------------PGAVSEVNNGTSRRA 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 28/94 (30%)
Ig 145..238 CDD:416386 27/92 (29%)
Ig strand A 145..149 CDD:409353 2/3 (67%)
Ig strand A' 154..159 CDD:409353 1/4 (25%)
Ig strand B 165..172 CDD:409353 3/6 (50%)
Ig strand C 178..183 CDD:409353 1/4 (25%)
Ig strand C' 185..187 CDD:409353 0/1 (0%)
Ig strand D 195..199 CDD:409353 0/3 (0%)
Ig strand E 203..209 CDD:409353 1/5 (20%)
Ig strand F 216..223 CDD:409353 3/6 (50%)
Ig strand G 230..238 CDD:409353 2/7 (29%)
Ig 242..333 CDD:416386 31/91 (34%)
Ig strand A' 250..253 CDD:409353 0/2 (0%)
Ig strand B 259..266 CDD:409353 2/6 (33%)
Ig strand C 272..277 CDD:409353 1/4 (25%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 0/3 (0%)
Ig strand E 295..305 CDD:409353 4/10 (40%)
Ig strand F 314..322 CDD:409353 4/7 (57%)
Ig strand G 325..334 CDD:409353 4/8 (50%)
NtmNP_001344522.1 Ig 44..132 CDD:416386 27/91 (30%)
Ig strand A' 44..49 CDD:409353 4/4 (100%)
Ig strand B 51..59 CDD:409353 3/7 (43%)
CDR1 59..63 CDD:409353 0/4 (0%)
FR2 64..70 CDD:409353 3/7 (43%)
Ig strand C 64..70 CDD:409353 3/7 (43%)
CDR2 71..83 CDD:409353 3/11 (27%)
Ig strand C' 72..76 CDD:409353 1/3 (33%)
Ig strand C' 80..83 CDD:409353 0/2 (0%)
FR3 84..118 CDD:409353 7/33 (21%)
Ig strand D 87..94 CDD:409353 1/6 (17%)
Ig strand E 97..103 CDD:409353 0/5 (0%)
Ig strand F 110..118 CDD:409353 3/7 (43%)
CDR3 119..123 CDD:409353 1/3 (33%)
Ig strand G 123..132 CDD:409353 4/9 (44%)
FR4 125..132 CDD:409353 3/7 (43%)
Ig_3 136..205 CDD:404760 23/78 (29%)
Ig strand A' 144..148 CDD:409353 0/3 (0%)
Ig strand B 151..160 CDD:409353 4/8 (50%)
Ig strand F 197..205 CDD:409353 4/7 (57%)
Ig_3 222..299 CDD:404760 25/81 (31%)
putative Ig strand A 223..229 CDD:409353 2/6 (33%)
Ig strand B 239..243 CDD:409353 1/3 (33%)
Ig strand C 252..256 CDD:409353 0/3 (0%)
Ig strand E 278..282 CDD:409353 2/3 (67%)
Ig strand F 292..297 CDD:409353 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11709
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I4449
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8732
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.