DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and Ntm

DIOPT Version :10

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001344522.1 Gene:Ntm / 235106 MGIID:2446259 Length:367 Species:Mus musculus


Alignment Length:366 Identity:102/366 - (27%)
Similarity:159/366 - (43%) Gaps:52/366 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 VMMDEPRFAQPIPNVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISRIPR-YSIT 102
            |...:..|.:.:.||||..|..|.|.|.::: ...:|||  ::|..||..........|| ..::
Mouse    31 VRSGDATFPKAMDNVTVRQGESATLRCTIDN-RVTRVAW--LNRSTILYAGNDKWCLDPRVVLLS 92

  Fly   103 YTDNTWLLHVNQAHQDDRGYYMCQVNT--NPMISQVGYLQVVVPPNILDIESTPSSVAVRENQNI 165
            .|...:.:.:......|.|.|.|.|.|  :|..|:| :|.|.|.|.|::|.   |.:::.|..||
Mouse    93 NTQTQYSIEIQNVDVYDEGPYTCSVQTDNHPKTSRV-HLIVQVSPKIVEIS---SDISINEGNNI 153

  Fly   166 NMTCRADGFPAPKIIWRREDGEEIAVEKKKKVLVYDADVLPLTKVSRNEMGAYLCIATNGVPPSV 230
            ::||.|.|.|.|.:.||.       :..|....|.:.:.|.:..::|.:.|.|.|.|:|.|...|
Mouse   154 SLTCIATGRPEPTVTWRH-------ISPKAVGFVSEDEYLEIQGITREQSGEYECSASNDVAAPV 211

  Fly   231 SKRIILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYWVYNSVMVLPSKKYKTDYTEN 295
            .:|:.:.|.:.|.| ...:..|.|.|...|:.|...|.|.|...|..:...::..||...  .||
Mouse   212 VRRVKVTVNYPPYI-SEAKGTGVPVGQKGTLQCEASAVPSAEFQWFKDDKRLVEGKKGVK--VEN 273

  Fly   296 SYRAHM-KLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEI--PLPSTPSKQVTHTTVESRENN 357
              |..: |||..|:...|:|||.|::.|.||.|..||.::|:  |..||..::|..|.:...:. 
Mouse   274 --RPFLSKLTFFNVSEHDYGNYTCVASNKLGHTNASIMLFELNEPTSSTLLQEVKTTALTPWKG- 335

  Fly   358 IIPSSRNDTTKSLQTDVGYAMKNDLYPGSASSSSSGGSSSA 398
                                      ||:.|..::|.|..|
Mouse   336 --------------------------PGAVSEVNNGTSRRA 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG_like 51..143 CDD:214653 28/94 (30%)
Ig strand B 61..65 CDD:409353 2/3 (67%)
Ig strand C 74..78 CDD:409353 2/3 (67%)
Ig strand E 105..112 CDD:409353 0/6 (0%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 134..137 CDD:409353 1/2 (50%)
Ig 145..238 CDD:472250 27/92 (29%)
Ig strand B 165..169 CDD:409353 1/3 (33%)
Ig strand C 178..182 CDD:409353 0/3 (0%)
Ig strand E 203..207 CDD:409353 1/3 (33%)
Ig strand F 217..222 CDD:409353 2/4 (50%)
Ig strand G 231..234 CDD:409353 0/2 (0%)
Ig 242..333 CDD:472250 31/91 (34%)
Ig strand B 259..263 CDD:409353 1/3 (33%)
Ig strand C 272..276 CDD:409353 0/3 (0%)
Ig strand E 295..305 CDD:409353 4/10 (40%)
Ig strand F 315..320 CDD:409353 3/4 (75%)
Ig strand G 328..331 CDD:409353 0/2 (0%)
NtmNP_001344522.1 Ig 44..132 CDD:472250 27/91 (30%)
Ig strand B 53..57 CDD:409353 2/3 (67%)
Ig strand C 65..69 CDD:409353 3/5 (60%)
Ig strand E 98..102 CDD:409353 0/3 (0%)
Ig strand F 112..117 CDD:409353 2/4 (50%)
Ig strand G 125..128 CDD:409353 1/2 (50%)
Ig_3 136..205 CDD:464046 23/78 (29%)
Ig 223..307 CDD:472250 29/88 (33%)
Ig strand B 239..243 CDD:409353 1/3 (33%)
Ig strand C 252..256 CDD:409353 0/3 (0%)
Ig strand E 278..282 CDD:409353 2/3 (67%)
Ig strand F 292..297 CDD:409353 3/4 (75%)

Return to query results.
Submit another query.