DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and Vsig10

DIOPT Version :9

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001028483.2 Gene:Vsig10 / 231668 MGIID:2448533 Length:558 Species:Mus musculus


Alignment Length:482 Identity:98/482 - (20%)
Similarity:168/482 - (34%) Gaps:132/482 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 AQPIPNV-----TVAVGR---DANLPCVVEHLGGYKVAWIHIDRQ--MILTIHRHVISRIPRYSI 101
            ::.:|.:     .||:|.   :..|.|.........|.|...|.:  .:::.:..:....||:|:
Mouse    39 SEVLPGIHPDLEAVAIGEVHDNVTLRCGSASGSRGLVTWYRNDSEPAFLVSFNSSLPPAAPRFSL 103

  Fly   102 TYTDNTWLLHVNQAHQDDRGYYMCQVNTN-----PMISQVGYLQVVVPPNILDIESTPSSV--AV 159
               ::...|.:.....:|.|.|.||...|     |:..:|......|..||....:.|:..  |.
Mouse   104 ---EDAGALRIEALRLEDDGNYTCQEVLNETHWFPVRLRVASGPAYVEVNISATGTLPNGTLYAA 165

  Fly   160 RENQNINMTCRADGFPAPKIIWRRED-------GEEIAVEKKKKVLVYDADVLPLTKVSRNEMGA 217
            |.:| ::..|.:...|.|::.|..:.       |:.::           |:...|..:|:|..|.
Mouse   166 RGSQ-VDFNCCSAAQPPPEVEWWIQTHSIPEFLGKNLS-----------ANSFTLMLMSQNLQGN 218

  Fly   218 YLCIATN---GVPPSVSKRIILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEA------------ 267
            |.|.|||   |....|:..::       :.|.|      ||....:::..:|:            
Mouse   219 YTCSATNVLSGRQRKVTTELL-------VYWPP------PSAPQCSVEVSSESTTLELACNWDGG 270

  Fly   268 HPKAIIYWVYNSVMVLPSKKYKTDYTENSYRAHMKL-TIRNLQYGDFGNYRCISKNSLGETEGSI 331
            :|.....|              |:....:...:.|| |:...|..:...::|:..:.||...|:.
Mouse   271 YPDPTFLW--------------TEEPGGTIMGNSKLQTLSPAQLLEGKKFKCVGNHILGPESGAS 321

  Fly   332 RVYEIPLPSTPSK---------QVTHTTVESRENNIIPSS-----RNDTTKSLQTDVGYAMKNDL 382
            .|.::..|..||:         .||.|...|..|   |.:     ||.|..::|....|.:    
Mouse   322 CVVKLSSPLLPSQPMRTCFVGGNVTLTCEVSGAN---PPARIQWLRNLTQPAIQPSSHYII---- 379

  Fly   383 YPGSASSSSSGGSSSAASSSSSM---------QTSALPGGVAGNSLSSMGSKGSLAIGKSTFYTE 438
                   :..|.|||....:.|.         |...|.|..|.|...|:  |..|.||       
Mouse   380 -------TQQGQSSSLTIHNCSQDLDEGFYYCQAENLVGVRATNIWLSV--KEPLNIG------- 428

  Fly   439 RPPNEYAASSVAGLLLHRALLFGSGIY 465
                ....:.|:.|||..|::.|..:|
Mouse   429 ----GIVGTVVSLLLLGLAVVSGLTLY 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 21/106 (20%)
Ig 145..238 CDD:416386 23/104 (22%)
Ig strand A 145..149 CDD:409353 2/3 (67%)
Ig strand A' 154..159 CDD:409353 1/6 (17%)
Ig strand B 165..172 CDD:409353 1/6 (17%)
Ig strand C 178..183 CDD:409353 1/4 (25%)
Ig strand C' 185..187 CDD:409353 0/8 (0%)
Ig strand D 195..199 CDD:409353 0/3 (0%)
Ig strand E 203..209 CDD:409353 1/5 (20%)
Ig strand F 216..223 CDD:409353 3/6 (50%)
Ig strand G 230..238 CDD:409353 1/7 (14%)
Ig 242..333 CDD:416386 16/103 (16%)
Ig strand A' 250..253 CDD:409353 0/2 (0%)
Ig strand B 259..266 CDD:409353 0/6 (0%)
Ig strand C 272..277 CDD:409353 1/4 (25%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 1/3 (33%)
Ig strand E 295..305 CDD:409353 2/10 (20%)
Ig strand F 314..322 CDD:409353 1/7 (14%)
Ig strand G 325..334 CDD:409353 2/8 (25%)
Vsig10NP_001028483.2 Ig 47..135 CDD:299845 18/90 (20%)
IG_like 55..140 CDD:214653 17/87 (20%)
IG_like 160..240 CDD:214653 20/98 (20%)
Ig <184..238 CDD:299845 14/64 (22%)
IG_like 341..421 CDD:214653 21/93 (23%)
Ig 345..418 CDD:143165 21/86 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 477..515
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 532..558
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.