DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-delta and Iglon5

DIOPT Version :9

Sequence 1:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001157990.1 Gene:Iglon5 / 210094 MGIID:2686277 Length:336 Species:Mus musculus


Alignment Length:326 Identity:94/326 - (28%)
Similarity:137/326 - (42%) Gaps:67/326 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 FAQPIPNVTVAVGRDANLPCVV-EHLGGYKVAWIHIDRQMILTIHRHVISRIPRYSITY-TDNTW 108
            |:.|..|.||..|.:|.|.|.: ||:  .:|||  ::|..||.......:..||..:.. |...:
Mouse    35 FSSPADNYTVCEGDNATLSCFIDEHV--TRVAW--LNRSNILYAGNDRWTSDPRVRLLINTPEEF 95

  Fly   109 LLHVNQAHQDDRGYYMCQVNT--NPMISQVGYLQVVVPPNILDIESTPSSVAVRENQNINMTCRA 171
            .:.:.|....|.|.|.|...|  .|..:|| ||.|.||..|::|.   |.|||.|..|:|:.|.|
Mouse    96 SILITQVGLGDEGLYTCSFQTRHQPYTTQV-YLIVHVPARIVNIS---SPVAVNEGGNVNLLCLA 156

  Fly   172 DGFPAPKIIWRR-EDGEEIAVEKKKKVLVYDADVLPLTKVSRNEMGAYLCIATNGVPPSV-SKRI 234
            .|.|.|.:.||: .||           ...:.::|.::.:.|.:.|.|.|:..|||..:. |:|:
Mouse   157 VGRPEPTVTWRQLRDG-----------FTSEGEILEISDIQRGQAGEYECVTHNGVNSAPDSRRV 210

  Fly   235 ILDVEFSPMIWVPNQLVGAPSGTDVT-----------IDCHTEAHPKAIIYWVYNSVMVLPS--- 285
            ::.|.:.|.|            ||||           :.|...|.|.|...| |....:|.|   
Mouse   211 LVTVNYPPTI------------TDVTSARTALGRAALLRCEAMAVPPADFQW-YKDDRLLSSGSA 262

  Fly   286 --KKYKTDYTENSYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVY-------EIPLPST 341
              .|.:|:      |....|...|:....:|||.|.:.|.||.:..|:|:.       ..|.|..
Mouse   263 EGLKVQTE------RTRSMLLFANVSARHYGNYTCRAANRLGASSASMRLLRPGSLENSAPRPPG 321

  Fly   342 P 342
            |
Mouse   322 P 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 30/95 (32%)
Ig 145..238 CDD:416386 28/94 (30%)
Ig strand A 145..149 CDD:409353 1/3 (33%)
Ig strand A' 154..159 CDD:409353 2/4 (50%)
Ig strand B 165..172 CDD:409353 2/6 (33%)
Ig strand C 178..183 CDD:409353 1/4 (25%)
Ig strand C' 185..187 CDD:409353 1/1 (100%)
Ig strand D 195..199 CDD:409353 0/3 (0%)
Ig strand E 203..209 CDD:409353 1/5 (20%)
Ig strand F 216..223 CDD:409353 3/6 (50%)
Ig strand G 230..238 CDD:409353 2/8 (25%)
Ig 242..333 CDD:416386 27/106 (25%)
Ig strand A' 250..253 CDD:409353 0/2 (0%)
Ig strand B 259..266 CDD:409353 3/17 (18%)
Ig strand C 272..277 CDD:409353 1/4 (25%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 1/3 (33%)
Ig strand E 295..305 CDD:409353 2/9 (22%)
Ig strand F 314..322 CDD:409353 4/7 (57%)
Ig strand G 325..334 CDD:409353 3/8 (38%)
Iglon5NP_001157990.1 Ig 41..129 CDD:416386 29/92 (32%)
Ig strand A' 41..46 CDD:409353 3/4 (75%)
Ig strand B 48..56 CDD:409353 3/7 (43%)
CDR1 56..60 CDD:409353 1/3 (33%)
FR2 61..68 CDD:409353 3/8 (38%)
Ig strand C 61..67 CDD:409353 3/7 (43%)
CDR2 69..79 CDD:409353 2/9 (22%)
Ig strand C' 71..74 CDD:409353 2/2 (100%)
Ig strand C' 76..79 CDD:409353 0/2 (0%)
FR3 80..115 CDD:409353 8/34 (24%)
Ig strand D 84..91 CDD:409353 1/6 (17%)
Ig strand E 94..100 CDD:409353 0/5 (0%)
Ig strand F 107..115 CDD:409353 3/7 (43%)
CDR3 116..120 CDD:409353 1/3 (33%)
Ig strand G 120..129 CDD:409353 5/9 (56%)
FR4 122..129 CDD:409353 4/7 (57%)
Ig strand A 132..137 CDD:409353 2/4 (50%)
Ig_3 134..199 CDD:404760 23/78 (29%)
Ig strand A' 140..145 CDD:409353 3/4 (75%)
Ig strand B 148..157 CDD:409353 3/8 (38%)
Ig strand C 163..167 CDD:409353 0/3 (0%)
Ig strand D 174..177 CDD:409353 0/2 (0%)
Ig strand E 178..183 CDD:409353 1/4 (25%)
Ig strand F 191..199 CDD:409353 3/7 (43%)
Ig_3 217..295 CDD:404760 23/96 (24%)
putative Ig strand A 218..224 CDD:409353 4/17 (24%)
Ig strand B 234..238 CDD:409353 0/3 (0%)
Ig strand C 247..251 CDD:409353 1/4 (25%)
Ig strand E 274..278 CDD:409353 1/3 (33%)
Ig strand F 288..293 CDD:409353 3/4 (75%)
Ig strand G 301..304 CDD:409353 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I12107
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I4449
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8732
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.