| Sequence 1: | NP_001097508.2 | Gene: | DIP-delta / 5740816 | FlyBaseID: | FBgn0085420 | Length: | 469 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_510069.1 | Gene: | zig-2 / 192087 | WormBaseID: | WBGene00006979 | Length: | 238 | Species: | Caenorhabditis elegans |
| Alignment Length: | 225 | Identity: | 55/225 - (24%) |
|---|---|---|---|
| Similarity: | 83/225 - (36%) | Gaps: | 60/225 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 147 ILDIESTPSSVAVRENQNINMTCRADGFPAPKIIWR----REDGEEIA------VEKKKKV---- 197
Fly 198 LVYDADVLPLTKVSRNEMGAYLCIATNGVPPSVSKRIILDVEFSPMIWVPNQLV-------GAP- 254
Fly 255 -----------SGTDVTIDCHTEAHPKAIIYWVYNSVMVLPSKKYKTDYTENSYRAHM----KLT 304
Fly 305 IRNLQYGDFGNYRCISKNSLGETEGSIRVY 334 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| DIP-delta | NP_001097508.2 | IG | 51..143 | CDD:214652 | |
| Ig | 145..238 | CDD:416386 | 28/104 (27%) | ||
| Ig strand A | 145..149 | CDD:409353 | 0/1 (0%) | ||
| Ig strand A' | 154..159 | CDD:409353 | 1/4 (25%) | ||
| Ig strand B | 165..172 | CDD:409353 | 1/6 (17%) | ||
| Ig strand C | 178..183 | CDD:409353 | 2/8 (25%) | ||
| Ig strand C' | 185..187 | CDD:409353 | 0/1 (0%) | ||
| Ig strand D | 195..199 | CDD:409353 | 2/7 (29%) | ||
| Ig strand E | 203..209 | CDD:409353 | 1/5 (20%) | ||
| Ig strand F | 216..223 | CDD:409353 | 5/6 (83%) | ||
| Ig strand G | 230..238 | CDD:409353 | 0/7 (0%) | ||
| Ig | 242..333 | CDD:416386 | 25/113 (22%) | ||
| Ig strand A' | 250..253 | CDD:409353 | 0/9 (0%) | ||
| Ig strand B | 259..266 | CDD:409353 | 2/6 (33%) | ||
| Ig strand C | 272..277 | CDD:409353 | 1/4 (25%) | ||
| Ig strand C' | 281..283 | CDD:409353 | 0/1 (0%) | ||
| Ig strand D | 289..293 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 295..305 | CDD:409353 | 3/13 (23%) | ||
| Ig strand F | 314..322 | CDD:409353 | 3/7 (43%) | ||
| Ig strand G | 325..334 | CDD:409353 | 3/8 (38%) | ||
| zig-2 | NP_510069.1 | I-set | 34..134 | CDD:254352 | 28/110 (25%) |
| Ig | 34..121 | CDD:299845 | 25/88 (28%) | ||
| Ig | <179..232 | CDD:299845 | 16/60 (27%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||